DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and CG7386

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster


Alignment Length:475 Identity:103/475 - (21%)
Similarity:167/475 - (35%) Gaps:132/475 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDLCRIC-----GGASENMLGIFDDQVEEYVDGAKLAEMVKTCADVQLDPDDAMPQKMCISCVH 60
            ::.||..|     .||..::..:.|           |.:.::.|.....|.:|..|:.:|..|..
  Fly     7 VQSLCLTCLVHLKHGAGHDLFVVPD-----------LFQKLRACTSFDADQNDGFPRNLCTQCFT 60

  Fly    61 DARTAYGFKRRCEENYKKF--------------YLAILNGQVIKDEP------------------ 93
            .....:.|:..|.|:.|:.              :.:|.:.....:.|                  
  Fly    61 KLNDLHDFRELCAESIKRLKEMMTSQRNMPMGVFESIADDSEAPERPEEPASFDPLLNNKLEMID 125

  Fly    94 NEED-FLFIENPDK-------------------GNLEAKKKLNKEIKKTHQTASRTTKSSITTSR 138
            |||| |..:|..||                   ..||.:||.::......:.|           .
  Fly   126 NEEDVFKLLEKVDKELEEHSRDQSEEHFSSAEHNGLEEEKKESEGFNSDDEQA-----------M 179

  Fly   139 AGRQLRSIKNQTFK---CELCIKQFKRQINLLDHMKVHSN--SHVCQ--NCEERFLFKADLDNHQ 196
            ..|::.:.|.:.|:   |.:|.::||:|....:|||.|::  ...||  :|.:.|.....|..|.
  Fly   180 GQRRIANDKRKLFRLMSCSICQQKFKKQSKFEEHMKHHNDLLPFQCQEESCRKGFTTAGALRLHV 244

  Fly   197 CYRNS--NSTVEC--PECLKVFSSTQSLDSH------KCKDMQERSPFQCPHCQQAFTREQNLKA 251
            .|.:|  ..||.|  ..|..|||..:.|..|      :.:.:..|....|..|...|.....:|.
  Fly   245 DYAHSKKEDTVPCTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVVFRCPVAMKK 309

  Fly   252 HLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIH 316
            |:..|...:.   |:.|:.|..||:..||||.|:..|.|.:.:.|.:|.....::|....||.||
  Fly   310 HMYTHTGEEL---PYPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIH 371

  Fly   317 TGEKPYQ-----------------------------CPHCPKTFSDNNNLAKHRRRHSDERPYKC 352
            |....::                             |.:|.|||........|...|:.|:..:|
  Fly   372 TQRNQFKCRICDYATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCEC 436

  Fly   353 SICLQDFRE----KHHLKRH 368
            .:|.:.|..    .:|||.|
  Fly   437 KVCDKKFLHSESLNNHLKIH 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 17/79 (22%)
COG5048 <153..368 CDD:227381 67/261 (26%)
C2H2 Zn finger 153..173 CDD:275368 8/19 (42%)
C2H2 Zn finger 179..196 CDD:275368 5/18 (28%)
C2H2 Zn finger 207..227 CDD:275370 7/27 (26%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
zf-H2C2_2 308..332 CDD:290200 9/52 (17%)
zf-C2H2 322..344 CDD:278523 6/50 (12%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..368 CDD:275368 6/19 (32%)
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 17/81 (21%)
C2H2 Zn finger 197..217 CDD:275368 8/19 (42%)
C2H2 Zn finger 294..314 CDD:275368 5/19 (26%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
C2H2 Zn finger 379..400 CDD:275368 0/20 (0%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.