DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and Kr

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:263 Identity:69/263 - (26%)
Similarity:99/263 - (37%) Gaps:69/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LEAKKKLNKEIKKTHQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINLLDHMKVH 173
            |..||:...||..:......|:...|:...:|....|..:.......|:...|      |..:  
  Fly   162 LSVKKEFQTEISMSVNDMYHTSGGPISPPSSGSSPNSTHDGAGGNAGCVGVSK------DPSR-- 218

  Fly   174 SNSHVCQNCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPFQCPH 238
            ..|..|:.|...|.:|..|.||:                             :......||:||.
  Fly   219 DKSFTCKICSRSFGYKHVLQNHE-----------------------------RTHTGEKPFECPE 254

  Fly   239 CQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNF 303
            |.:.|||:.:||.|:.:|.    |..|:.||:|...|..                      |:|.
  Fly   255 CHKRFTRDHHLKTHMRLHT----GEKPYHCSHCDRQFVQ----------------------VANL 293

  Fly   304 RSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLKRH 368
            |.      |:|:||||:||.|..|...|||:|.|..|...|:.|:|::|..|...||.:|||..|
  Fly   294 RR------HLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNH 352

  Fly   369 FLG 371
            ..|
  Fly   353 KCG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 58/214 (27%)
C2H2 Zn finger 153..173 CDD:275368 3/19 (16%)
C2H2 Zn finger 179..196 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..227 CDD:275370 0/19 (0%)
C2H2 Zn finger 236..256 CDD:275368 9/19 (47%)
C2H2 Zn finger 268..288 CDD:275368 4/19 (21%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
zf-H2C2_2 308..332 CDD:290200 10/23 (43%)
zf-C2H2 322..344 CDD:278523 9/21 (43%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
C2H2 Zn finger 352..368 CDD:275368 7/15 (47%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 7/48 (15%)
zf-H2C2_2 237..261 CDD:290200 9/52 (17%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
zf-H2C2_2 264..289 CDD:290200 10/28 (36%)
C2H2 Zn finger 280..300 CDD:275368 9/47 (19%)
zf-H2C2_2 292..316 CDD:290200 12/29 (41%)
C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..345 CDD:290200 8/23 (35%)
C2H2 Zn finger 336..352 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.