Sequence 1: | NP_649920.2 | Gene: | CG8319 / 41165 | FlyBaseID: | FBgn0037722 | Length: | 383 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261181.1 | Gene: | Kr / 38012 | FlyBaseID: | FBgn0001325 | Length: | 502 | Species: | Drosophila melanogaster |
Alignment Length: | 263 | Identity: | 69/263 - (26%) |
---|---|---|---|
Similarity: | 99/263 - (37%) | Gaps: | 69/263 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 LEAKKKLNKEIKKTHQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINLLDHMKVH 173
Fly 174 SNSHVCQNCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPFQCPH 238
Fly 239 CQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNF 303
Fly 304 RSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLKRH 368
Fly 369 FLG 371 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8319 | NP_649920.2 | zf-AD | 4..79 | CDD:285071 | |
COG5048 | <153..368 | CDD:227381 | 58/214 (27%) | ||
C2H2 Zn finger | 153..173 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 179..196 | CDD:275368 | 6/16 (38%) | ||
C2H2 Zn finger | 207..227 | CDD:275370 | 0/19 (0%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 296..316 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 308..332 | CDD:290200 | 10/23 (43%) | ||
zf-C2H2 | 322..344 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 352..368 | CDD:275368 | 7/15 (47%) | ||
Kr | NP_001261181.1 | C2H2 Zn finger | 224..244 | CDD:275368 | 7/48 (15%) |
zf-H2C2_2 | 237..261 | CDD:290200 | 9/52 (17%) | ||
C2H2 Zn finger | 252..272 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 264..289 | CDD:290200 | 10/28 (36%) | ||
C2H2 Zn finger | 280..300 | CDD:275368 | 9/47 (19%) | ||
zf-H2C2_2 | 292..316 | CDD:290200 | 12/29 (41%) | ||
C2H2 Zn finger | 308..328 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 321..345 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 336..352 | CDD:275368 | 7/15 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |