| Sequence 1: | NP_649920.2 | Gene: | CG8319 / 41165 | FlyBaseID: | FBgn0037722 | Length: | 383 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
| Alignment Length: | 205 | Identity: | 61/205 - (29%) |
|---|---|---|---|
| Similarity: | 94/205 - (45%) | Gaps: | 35/205 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 174 SNSHVCQNCEERFLFKAD--LDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPFQC 236
Fly 237 PHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVS 301
Fly 302 NFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLK 366
Fly 367 RHFLGKHRDG 376 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8319 | NP_649920.2 | zf-AD | 4..79 | CDD:285071 | |
| COG5048 | <153..368 | CDD:227381 | 58/195 (30%) | ||
| C2H2 Zn finger | 153..173 | CDD:275368 | |||
| C2H2 Zn finger | 179..196 | CDD:275368 | 6/18 (33%) | ||
| C2H2 Zn finger | 207..227 | CDD:275370 | 7/19 (37%) | ||
| C2H2 Zn finger | 236..256 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 0/19 (0%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 308..332 | CDD:290200 | 10/23 (43%) | ||
| zf-C2H2 | 322..344 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 324..344 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 352..368 | CDD:275368 | 4/15 (27%) | ||
| CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 60/200 (30%) |
| C2H2 Zn finger | 18..39 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 48..68 | CDD:275368 | 8/20 (40%) | ||
| C2H2 Zn finger | 76..96 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 104..124 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 132..148 | CDD:275368 | 6/15 (40%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45449797 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||