DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and CG30431

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:391 Identity:105/391 - (26%)
Similarity:160/391 - (40%) Gaps:82/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YVDGAKLAEMVKTCAD-VQLDPDDAMPQKMCISC---VHDARTAYGFKRRCEEN---------YK 77
            |...::||..:|..|. ::|:..|.:...:|..|   :||||   .|:||||.:         :.
  Fly    27 YDASSQLAVELKALAPALRLEHGDNLTDVICDLCLRRLHDAR---DFQRRCEHSEQVLRMRHEHW 88

  Fly    78 KFYLAILNGQVIKD--EPNEEDFLFIENPDKGNLEAKKKLN--KEIKKT-------HQTASRTT- 130
            |..:|:.:...:.|  |..|.:...:|.|....|:|.|.:.  ..:.:|       .|.:|.:. 
  Fly    89 KHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVAPLMETVDFESLDFQDSSHSEH 153

  Fly   131 ------KSSITTSRAGRQLRSIKNQTFKCELCI--------------------KQFKRQINLLDH 169
                  :||:.:.    .|.:..:|....||..                    .:.:|.....|:
  Fly   154 DIPSYWESSVDSG----SLNTPHHQPETAELFAVEPPTPPESSEEPAPDAAEKPKMRRARPRQDN 214

  Fly   170 MK---------VHSNS-HVCQNCEERFL--FKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDS 222
            :|         ||..| |.|..||::|.  |:..|.....:.......:|.||.|.|:|..||..
  Fly   215 VKPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRY 279

  Fly   223 H-KCKDMQERSPFQCPHCQQAFTREQNLKAHLLIH-AESKQGNGPH--KCSYCQTGFFNKSALKV 283
            | |.....|| ||.|.||.:.|.....|.:||..| .|:|    |.  :|..|...:..||.|:.
  Fly   280 HVKSVHSTER-PFGCQHCDRRFILRTQLLSHLRTHTGEAK----PRIFECQRCSKSWPTKSDLRT 339

  Fly   284 HIHAHMG--ERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHR-RRHS 345
            |:.:|..  |||..|..|...|.::..|..|:.:||||||:.|.:|.|.:....||..|. |.|:
  Fly   340 HMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLHA 404

  Fly   346 D 346
            |
  Fly   405 D 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 18/65 (28%)
COG5048 <153..368 CDD:227381 70/233 (30%)
C2H2 Zn finger 153..173 CDD:275368 5/48 (10%)
C2H2 Zn finger 179..196 CDD:275368 6/18 (33%)
C2H2 Zn finger 207..227 CDD:275370 10/20 (50%)
C2H2 Zn finger 236..256 CDD:275368 7/19 (37%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
zf-H2C2_2 308..332 CDD:290200 11/23 (48%)
zf-C2H2 322..344 CDD:278523 7/22 (32%)
C2H2 Zn finger 324..344 CDD:275368 7/20 (35%)
C2H2 Zn finger 352..368 CDD:275368
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 18/57 (32%)
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 10/20 (50%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 22/71 (31%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 5/19 (26%)
zf-H2C2_2 366..389 CDD:290200 11/22 (50%)
C2H2 Zn finger 382..403 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.