DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and Plzf

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:397 Identity:100/397 - (25%)
Similarity:157/397 - (39%) Gaps:74/397 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VQLDPDDAM-----------------------------PQKM------CISCVHDARTAYGF--- 68
            ::||.||::                             |.|:      |..|:|   |...|   
  Fly    39 LELDSDDSLSLSVHFCVLAAQSQFINSNQKQQQFSIHNPLKITIRNFSCTQCLH---TIVDFFYE 100

  Fly    69 -----KRRCEENYKKF--YLAI---LNGQVIKDEPNEEDFLFIENPDKGNLEAKKKLNKEIKKTH 123
                 .:..|.::::.  .||:   ||  :.:.:|..|.....|.|..|  ||:...:.|.|...
  Fly   101 DLVSVSKEHELHFRELAQILAVTELLN--LYQLQPLGEAKEATEIPAPG--EAQPNPDPEKKAEA 161

  Fly   124 QTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINLLDHMKVHSNSH-VCQNCEERFL 187
            ...:|.:...:...||.:....: |....|:....|.::   :::||.....|| :|..||..||
  Fly   162 VFENRQSYFKLKNPRAVKSSSKV-NYCIGCDFKCYQVQK---MIEHMGSCEPSHLICSLCEVGFL 222

  Fly   188 FKADLDNHQCYRNSNSTVE---CPECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQQAFTREQNL 249
            ...:.|.| ..|:|....:   |.:|...|::..:|..|:.|...| :|..||||.:.|..:|.|
  Fly   223 DWREYDTH-LRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTE-TPHICPHCGKGFKWKQGL 285

  Fly   250 KAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPF--CVSNFRSKQALKVH 312
            ..|:|:|...||    ..|..|.....:..|||.|...|.||. .||..  |......|:.||:|
  Fly   286 SNHILVHNPEKQ----MLCDVCGYSTTHMKALKSHKLLHTGEF-FACTVSGCKHRANRKENLKLH 345

  Fly   313 IRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERP--YKCSICLQDFREKHHLKRHFLGKHRD 375
            |..|...:.:.|..|...||.:.||.:|..:|::..|  |||.:|.........:|.|....|.:
  Fly   346 IETHKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRVHTE 410

  Fly   376 GDQKLKL 382
            ...:|:|
  Fly   411 KPVQLEL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 12/79 (15%)
COG5048 <153..368 CDD:227381 67/222 (30%)
C2H2 Zn finger 153..173 CDD:275368 4/19 (21%)
C2H2 Zn finger 179..196 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..227 CDD:275370 5/19 (26%)
C2H2 Zn finger 236..256 CDD:275368 9/19 (47%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 7/21 (33%)
zf-H2C2_2 308..332 CDD:290200 7/23 (30%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..368 CDD:275368 3/15 (20%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 66/219 (30%)
C2H2 Zn finger 214..234 CDD:275368 7/20 (35%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..292 CDD:275368 9/19 (47%)
C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..349 CDD:275368 6/18 (33%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 387..408 CDD:275368 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.