DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and CG11695

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:504 Identity:102/504 - (20%)
Similarity:186/504 - (36%) Gaps:152/504 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCRICGGASENMLGIF--DDQVEEYVDGAKLAEMVKTCADVQLDPDDAMPQKMCISCVHDARTAY 66
            :||:|...:|:.:.||  ||..::.|. :.|||:::....:.|.|:|.:.:.:|..|.....   
  Fly     2 ICRLCLDDAEHSVPIFDQDDSGDQPVP-SNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLA--- 62

  Fly    67 GFKRRCEENYKKFYLAILNGQVIKDEPNEEDFLFIENPD-KGNLEAKKKL--------NKEIKKT 122
            .|::.|....||    .|..|.:|.||..||    |:.| |..:..:.::        |:|..:.
  Fly    63 DFEQFCAMVMKK----QLGLQQLKMEPFSED----EDADTKAQILCEPEIDVSPAAADNEECNEI 119

  Fly   123 HQTASRTTKSSITTSRAGRQLR-------------------------SIKNQTFKCE-------- 154
            ...||..::||...:.:.|::|                         ..:.:|.|.|        
  Fly   120 DGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDAE 184

  Fly   155 ---------------------------------------------------------LCIKQFKR 162
                                                                     .|.:::|:
  Fly   185 GEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKK 249

  Fly   163 QINLLDHMKVHS--NSHVCQNCEERFLFKADLDNHQCYRNSNS---TVECPECLKVFSSTQSLDS 222
            :...:||:.:|:  |...|:.|.::.:.:...|.|....:.|.   :..|.:|.|.||....|..
  Fly   250 RALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCSKRFSKQFLLTI 314

  Fly   223 HKCKDMQERSPFQCPHCQQAFTREQNLKAH--------------------------LLIHAESKQ 261
            |.....|||:. ||.||.::|....:|:.|                          ||:|..:..
  Fly   315 HSRVHQQERNE-QCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVH 378

  Fly   262 GNGPH----KCSYCQTGFFNKSALKVHIHAHMGE---RPHACPFCVSNFRSKQALKVHIRIHTGE 319
            ..|..    :|..||....::::|:.|::.|:..   |...|..|.....|:..|..|||.|..:
  Fly   379 REGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPK 443

  Fly   320 KPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLKRH 368
            :.::|.||.|.|..:.:|.:|...|:.:..|:|:.|.:.|:...::.:|
  Fly   444 EYHKCTHCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKH 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 20/76 (26%)
COG5048 <153..368 CDD:227381 60/317 (19%)
C2H2 Zn finger 153..173 CDD:275368 5/84 (6%)
C2H2 Zn finger 179..196 CDD:275368 3/16 (19%)
C2H2 Zn finger 207..227 CDD:275370 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 8/45 (18%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-H2C2_2 308..332 CDD:290200 9/23 (39%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..368 CDD:275368 3/15 (20%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 23/86 (27%)
C2H2 Zn finger 268..289 CDD:275368 4/20 (20%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 6/20 (30%)
C2H2 Zn finger 357..376 CDD:275368 3/18 (17%)
C2H2 Zn finger 389..409 CDD:275368 5/19 (26%)
C2H2 Zn finger 420..440 CDD:275368 7/19 (37%)
C2H2 Zn finger 448..468 CDD:275368 7/19 (37%)
C2H2 Zn finger 476..494 CDD:275368 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.