DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and ZNF763

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001012771.1 Gene:ZNF763 / 284390 HGNCID:27614 Length:397 Species:Homo sapiens


Alignment Length:329 Identity:85/329 - (25%)
Similarity:138/329 - (41%) Gaps:59/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ENYKKFYLAILNGQV--IKDEPNEEDFLFIENPD--------KGNLEAK--------------KK 114
            :|.::.:.:::.|.|  ||::.:..: .|.:.||        |.:.|||              ..
Human    60 QNPRRNFRSLIEGNVNEIKEDSHCGE-TFTQVPDDRLNFQEKKASPEAKSCDNFVCGEVGIGNSS 123

  Fly   115 LNKEIK-----KTHQTASRTTK--SSITTSRAGRQLRSIKNQ--------TFKCELCIKQFKRQI 164
            .|..|:     |.::......|  ......:|.|...|.:.|        .:.|:.|.|.|....
Human   124 FNMNIRGDIGHKAYEYQDYAPKPYKCQQPKKAFRYHPSFRTQERNHTGEKPYACKECGKTFISHS 188

  Fly   165 NLLDHMKVHSNS--HVCQ------NCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLD 221
            .:...|.:||..  :.|:      :|...:|.      |:.........||.:|:|.||.:.:..
Human   189 GIRRRMVMHSGDGPYKCKFCGKAVHCLRLYLI------HERTHTGEKPYECKQCVKSFSYSATHR 247

  Fly   222 SHKCKDMQERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIH 286
            .|:.....|: |::|..|.:||....:.:||...|.    |..|::|..|...|....:.::|..
Human   248 IHERTHTGEK-PYECQQCGKAFHSSSSFQAHKRTHT----GGKPYECKQCGKSFSWCHSFQIHER 307

  Fly   287 AHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYK 351
            .|.||:|..|..|...|||.::...|.|.|||||||||..|.|.|:..::|.:|.|.||.::||:
Human   308 THTGEKPCECSKCNKAFRSYRSYLRHKRSHTGEKPYQCKECRKAFTYPSSLRRHERTHSAKKPYE 372

  Fly   352 CSIC 355
            |..|
Human   373 CKQC 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 1/4 (25%)
COG5048 <153..368 CDD:227381 65/211 (31%)
C2H2 Zn finger 153..173 CDD:275368 5/19 (26%)
C2H2 Zn finger 179..196 CDD:275368 3/22 (14%)
C2H2 Zn finger 207..227 CDD:275370 6/19 (32%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..288 CDD:275368 4/19 (21%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-H2C2_2 308..332 CDD:290200 13/23 (57%)
zf-C2H2 322..344 CDD:278523 9/21 (43%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..368 CDD:275368 2/4 (50%)
ZNF763NP_001012771.1 KRAB 7..>49 CDD:214630
KRAB 7..46 CDD:279668
C2H2 Zn finger 149..169 CDD:275368 4/19 (21%)
COG5048 202..>390 CDD:227381 58/186 (31%)
C2H2 Zn finger 205..225 CDD:275368 4/25 (16%)
zf-H2C2_2 221..242 CDD:290200 6/20 (30%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
zf-H2C2_2 247..270 CDD:290200 7/23 (30%)
C2H2 Zn finger 261..281 CDD:275368 6/19 (32%)
zf-H2C2_2 273..297 CDD:290200 7/27 (26%)
C2H2 Zn finger 289..309 CDD:275368 4/19 (21%)
zf-H2C2_2 301..326 CDD:290200 8/24 (33%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
zf-H2C2_2 332..354 CDD:290200 14/21 (67%)
DUF45 <342..383 CDD:302795 16/35 (46%)
C2H2 Zn finger 345..365 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.