DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and znf-782

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_500033.1 Gene:znf-782 / 190310 WormBaseID:WBGene00021931 Length:662 Species:Caenorhabditis elegans


Alignment Length:321 Identity:88/321 - (27%)
Similarity:135/321 - (42%) Gaps:53/321 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EPNEEDFLFIENPDKGNLEAKKKLNKEIKKTHQTASRTTKSSI---------------------- 134
            :|.||:|   |..:...||.:::.::|:::...:.|.::..|.                      
 Worm    23 DPEEEEF---EEYEDELLEEEEEFDEELEELENSDSASSLVSAGSPHGSSSSNGSHGSSPPLQVQ 84

  Fly   135 TTSRAGRQLRSIKNQTFK---CELCIKQFKRQINLLDHMKVHSNS--HVCQNCEERFLFKADLDN 194
            :.|:......|...|..|   |.:|.|.|.....|..|.:.|:..  :.|..|::.|..||.|..
 Worm    85 SPSQGSGSSGSPTGQPEKRHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQV 149

  Fly   195 HQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSP------FQCPHCQQAFTREQNLKAHL 253
            |:.........:|..|.|.|:      .:..|.:.|:|.      ::||.|.:..:....|..|.
 Worm   150 HERTHTGERPYKCRYCEKTFA------QYGTKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHK 208

  Fly   254 LIHAESKQGNGPHKCSYCQTGFFNKSALKVHI-HAH-MGERPHACPFCVSNFRSKQALKVHIRIH 316
            ..|     |:...:|.:|...|..|:.||:|: ..| ..||.|.|.:|...|....:|:||:|.|
 Worm   209 KTH-----GDKTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTH 268

  Fly   317 TGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKH----HLKRHFLGKH 373
            |||:||.|..|||.|:...||..|.|.|:.||||.|..|.:.|.:|.    |...|...||
 Worm   269 TGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 71/228 (31%)
C2H2 Zn finger 153..173 CDD:275368 6/19 (32%)
C2H2 Zn finger 179..196 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..227 CDD:275370 4/19 (21%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
C2H2 Zn finger 268..288 CDD:275368 7/20 (35%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-H2C2_2 308..332 CDD:290200 14/23 (61%)
zf-C2H2 322..344 CDD:278523 10/21 (48%)
C2H2 Zn finger 324..344 CDD:275368 9/19 (47%)
C2H2 Zn finger 352..368 CDD:275368 5/19 (26%)
znf-782NP_500033.1 C2H2 Zn finger 106..126 CDD:275368 6/19 (32%)
zf-H2C2_2 119..143 CDD:290200 6/23 (26%)
C2H2 Zn finger 134..154 CDD:275368 7/19 (37%)
zf-H2C2_2 147..171 CDD:290200 6/29 (21%)
C2H2 Zn finger 162..180 CDD:275368 5/23 (22%)
COG5048 <187..404 CDD:227381 53/148 (36%)
C2H2 Zn finger 191..211 CDD:275370 5/19 (26%)
C2H2 Zn finger 218..239 CDD:275368 7/20 (35%)
C2H2 Zn finger 248..268 CDD:275368 7/19 (37%)
zf-H2C2_2 260..285 CDD:290200 15/24 (63%)
C2H2 Zn finger 276..296 CDD:275368 9/19 (47%)
zf-H2C2_2 288..313 CDD:290200 12/24 (50%)
C2H2 Zn finger 304..324 CDD:275368 5/19 (26%)
C2H2 Zn finger 386..403 CDD:275368
C2H2 Zn finger 424..441 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.