DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and odd-2

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_509032.1 Gene:odd-2 / 183219 WormBaseID:WBGene00003846 Length:254 Species:Caenorhabditis elegans


Alignment Length:164 Identity:42/164 - (25%)
Similarity:63/164 - (38%) Gaps:32/164 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 ERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCS-------------YCQTGFFNKSAL 281
            :::.|...|...:...||.:|         ::...| |.|             |.|..|......
 Worm    57 KKAKFDFTHMADSIESEQKIK---------EESVSP-KMSPTLTTAAVRPFVPYDQPWFMIPGRG 111

  Fly   282 KVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSD 346
            :....|...::...|.:|..:|.....|.:|.|.||.|:||.|..|.|.|...::|..|:..|..
 Worm   112 RTTGRAARPKKEFICKYCDRHFTKSYNLLIHERTHTDERPYSCDVCGKAFRRQDHLRDHKYIHQK 176

  Fly   347 ERPYKCSICLQDF---------REKHHLKRHFLG 371
            :||:||.||.:.|         |..|...||.:|
 Worm   177 DRPFKCEICGKGFCQSRTLLVHRATHDPNRHSIG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 39/159 (25%)
C2H2 Zn finger 153..173 CDD:275368
C2H2 Zn finger 179..196 CDD:275368
C2H2 Zn finger 207..227 CDD:275370
C2H2 Zn finger 236..256 CDD:275368 4/19 (21%)
C2H2 Zn finger 268..288 CDD:275368 4/32 (13%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
zf-H2C2_2 308..332 CDD:290200 11/23 (48%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..368 CDD:275368 6/24 (25%)
odd-2NP_509032.1 zf-C2H2 124..146 CDD:278523 6/21 (29%)
C2H2 Zn finger 126..146 CDD:275368 6/19 (32%)
zf-H2C2_2 138..163 CDD:290200 12/24 (50%)
C2H2 Zn finger 154..174 CDD:275368 6/19 (32%)
zf-H2C2_2 166..189 CDD:290200 9/22 (41%)
zf-C2H2 180..202 CDD:278523 6/21 (29%)
C2H2 Zn finger 182..202 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.