DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and zag-1

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_500424.3 Gene:zag-1 / 177144 WormBaseID:WBGene00006970 Length:596 Species:Caenorhabditis elegans


Alignment Length:93 Identity:35/93 - (37%)
Similarity:52/93 - (55%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 KQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQC 324
            |:..|...|..|...|..:|:|..|.:.|.|:||:.|..|...|:.|..|..|.|:|:||||:||
 Worm   475 KEEEGLFSCDQCDKVFGKQSSLARHKYEHSGQRPYKCDICEKAFKHKHHLTEHKRLHSGEKPFQC 539

  Fly   325 PHCPKTFSDNNNLAKH-RRRHSDERPYK 351
            ..|.|.||.:.:.::| ..|:|..:||:
 Worm   540 DKCLKRFSHSGSYSQHMNHRYSYCKPYR 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 35/93 (38%)
C2H2 Zn finger 153..173 CDD:275368
C2H2 Zn finger 179..196 CDD:275368
C2H2 Zn finger 207..227 CDD:275370
C2H2 Zn finger 236..256 CDD:275368
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-H2C2_2 308..332 CDD:290200 12/23 (52%)
zf-C2H2 322..344 CDD:278523 7/22 (32%)
C2H2 Zn finger 324..344 CDD:275368 6/20 (30%)
C2H2 Zn finger 352..368 CDD:275368 35/93 (38%)
zag-1NP_500424.3 zf-C2H2 24..46 CDD:278523
C2H2 Zn finger 26..46 CDD:275368
zf-H2C2_2 38..61 CDD:290200
homeodomain 225..282 CDD:238039
C2H2 Zn finger 483..503 CDD:275368 6/19 (32%)
zf-H2C2_2 495..520 CDD:290200 9/24 (38%)
COG5048 506..>559 CDD:227381 21/52 (40%)
C2H2 Zn finger 511..531 CDD:275368 7/19 (37%)
zf-H2C2_2 523..548 CDD:290200 13/24 (54%)
C2H2 Zn finger 539..556 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I3383
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.