DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and ZK546.5

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001364799.1 Gene:ZK546.5 / 173850 WormBaseID:WBGene00022762 Length:581 Species:Caenorhabditis elegans


Alignment Length:415 Identity:83/415 - (20%)
Similarity:125/415 - (30%) Gaps:140/415 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KRRCEENYKKFYLAILNGQVIKDEPNEEDFLFIENPDKG--NLEAKKKLNKEIKKTHQTASRTTK 131
            |.|.|....:...|:|.|               ..|..|  ..||....|..:...|.||   .:
 Worm   134 KMRHEARAHQLVKAVLAG---------------NQPTVGGEQYEACTICNMLVNIAHPTA---ME 180

  Fly   132 SSITTSRAGRQLR----------SIKNQTFKCELCIKQFKRQINLLDHMKVH---SNSHVCQNC- 182
            |.....:...:||          .::|.|  ||||...|.....|..|:..|   ...::|:.| 
 Worm   181 SHQRAHKKNDELRLQLIDRLGAHEVQNLT--CELCSLVFPDDGKLRAHVTSHHTRRKKYICKFCG 243

  Fly   183 ------EERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPFQ------ 235
                  .|..|.|.|:.|:..:.|      .||.||...:....|..: |.::.|:.|:      
 Worm   244 HISHSMSELNLHKNDVHNYTAWAN------VPEYLKSRRTFYQYDEEQ-KRLRRRTNFEMADEMS 301

  Fly   236 -------------------CPHCQQAFTREQNLKAHL-LIHAESKQGNGPHKCSYCQTGFFNKSA 280
                               ||.|.....|.:.|..|: .:|.:|.     ..| ..:||......
 Worm   302 IRLPILGEISDGDTAGRVTCPECGLKLNRPRLLFKHMERVHMKSS-----FSC-MVETGGLPTFE 360

  Fly   281 LKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIH-----------TGEKPYQCPHCPKTFSDN 334
            |:|    ..||....|  |.|.|.::.....|.|:|           :.|.|...|...:....:
 Worm   361 LEV----SNGEIFWTC--CDSKFDNRPEFIEHRRLHIPTQHEEVVVESSEDPNDIPSTSQAMIPD 419

  Fly   335 NNLAKHRRRHS------DERPYKCSICL---QDFRE-------------------------KHHL 365
            .:..:...:|:      ||.. ...:.|   .|.||                         .|||
 Worm   420 EDANEAAEQHNFPQMIHDEHG-NIQVLLPEGYDLRETYYIYDENGTKIQLVPLQQPDGTIDHHHL 483

  Fly   366 KRHFLGKH-------RDGDQKLKLK 383
            ...|...|       .:||:.:.|:
 Worm   484 VPQFEINHEGEEQIIEEGDEMMALE 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 3/9 (33%)
COG5048 <153..368 CDD:227381 59/295 (20%)
C2H2 Zn finger 153..173 CDD:275368 7/19 (37%)
C2H2 Zn finger 179..196 CDD:275368 7/23 (30%)
C2H2 Zn finger 207..227 CDD:275370 5/19 (26%)
C2H2 Zn finger 236..256 CDD:275368 6/20 (30%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
zf-H2C2_2 308..332 CDD:290200 6/34 (18%)
zf-C2H2 322..344 CDD:278523 1/21 (5%)
C2H2 Zn finger 324..344 CDD:275368 1/19 (5%)
C2H2 Zn finger 352..368 CDD:275368 7/43 (16%)
ZK546.5NP_001364799.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.