DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and klu-2

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_491843.3 Gene:klu-2 / 172339 WormBaseID:WBGene00022592 Length:386 Species:Caenorhabditis elegans


Alignment Length:109 Identity:41/109 - (37%)
Similarity:53/109 - (48%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 GERP--HACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKC 352
            |..|  :.|..|..:||....|..|.|.||||||::|..|.:.||.:::|..|||.|:||:||.|
 Worm   241 GSAPGQYYCFICEKDFRRPDILSRHTRRHTGEKPFKCEDCGRFFSRSDHLRTHRRTHTDEKPYHC 305

  Fly   353 SICLQDFREKHHLKRH------------FLGKHR-------DGD 377
            .:|....|.:..|.||            .||.||       |||
 Worm   306 CVCNYSARRRDVLTRHMSTRHQAIAPPSILGTHRNVRRCLSDGD 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 32/79 (41%)
C2H2 Zn finger 153..173 CDD:275368
C2H2 Zn finger 179..196 CDD:275368
C2H2 Zn finger 207..227 CDD:275370
C2H2 Zn finger 236..256 CDD:275368
C2H2 Zn finger 268..288 CDD:275368
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-H2C2_2 308..332 CDD:290200 11/23 (48%)
zf-C2H2 322..344 CDD:278523 8/21 (38%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
C2H2 Zn finger 352..368 CDD:275368 4/15 (27%)
klu-2NP_491843.3 COG5048 216..>298 CDD:227381 23/56 (41%)
C2H2 Zn finger 249..269 CDD:275368 7/19 (37%)
zf-H2C2_2 262..286 CDD:290200 12/23 (52%)
COG5048 273..>328 CDD:227381 21/54 (39%)
C2H2 Zn finger 277..297 CDD:275368 8/19 (42%)
zf-H2C2_2 289..314 CDD:290200 11/24 (46%)
C2H2 Zn finger 305..324 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.