DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and ZNF358

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_060553.4 Gene:ZNF358 / 140467 HGNCID:16838 Length:568 Species:Homo sapiens


Alignment Length:241 Identity:86/241 - (35%)
Similarity:111/241 - (46%) Gaps:7/241 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 TKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINLLDHMKVHSNS--HVCQNCEERFLFKADL 192
            |...:.||.|.....:...:.|.|..|.:.|:|...|..|.:.||..  :.|.:|.:.|...|.|
Human   130 TPQVLATSPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSFSHGATL 194

  Fly   193 DNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQQAFTREQNLKAHLLIHA 257
            ..|:.........:|..|.|.|....:|..|:.....|: |..||.|.:||.....|..||..|.
Human   195 AQHRGIHTGARPYQCAACGKAFGWRSTLLKHRSSHSGEK-PHHCPVCGKAFGHGSLLAQHLRTHG 258

  Fly   258 ESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPY 322
                |..||||..|..||...|||..|:..|.||||:.||.|...|....||..|.|.||.|:||
Human   259 ----GPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPY 319

  Fly   323 QCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLKRH 368
            :||||.|.|..::||..|.|.|:.||||.|..|.:.|.:...|.:|
Human   320 RCPHCGKAFGQSSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQH 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 80/216 (37%)
C2H2 Zn finger 153..173 CDD:275368 6/19 (32%)
C2H2 Zn finger 179..196 CDD:275368 5/16 (31%)
C2H2 Zn finger 207..227 CDD:275370 6/19 (32%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
zf-H2C2_2 308..332 CDD:290200 14/23 (61%)
zf-C2H2 322..344 CDD:278523 11/21 (52%)
C2H2 Zn finger 324..344 CDD:275368 10/19 (53%)
C2H2 Zn finger 352..368 CDD:275368 4/15 (27%)
ZNF358NP_060553.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117
COG5048 <35..339 CDD:227381 75/213 (35%)
lambda-1 108..>174 CDD:212564 11/43 (26%)
zf-C2H2 151..173 CDD:278523 7/21 (33%)
C2H2 Zn finger 153..173 CDD:275368 6/19 (32%)
zf-H2C2_2 166..190 CDD:290200 7/23 (30%)
C2H2 Zn finger 181..201 CDD:275368 6/19 (32%)
zf-H2C2_2 194..216 CDD:290200 5/21 (24%)
C2H2 Zn finger 209..229 CDD:275368 6/19 (32%)
zf-H2C2_2 222..244 CDD:290200 7/22 (32%)
C2H2 Zn finger 237..257 CDD:275368 8/19 (42%)
zf-H2C2_2 250..272 CDD:290200 10/25 (40%)
C2H2 Zn finger 265..285 CDD:275368 8/19 (42%)
zf-H2C2_2 277..300 CDD:290200 11/22 (50%)
zf-C2H2_8 292..370 CDD:292531 33/74 (45%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
zf-H2C2_2 305..328 CDD:290200 14/22 (64%)
C2H2 Zn finger 321..341 CDD:275368 10/19 (53%)
zf-H2C2_2 333..356 CDD:290200 11/22 (50%)
C2H2 Zn finger 349..369 CDD:275368 5/17 (29%)
zf-H2C2_2 361..384 CDD:290200 2/5 (40%)
zf-C2H2 375..397 CDD:278523
C2H2 Zn finger 377..397 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 448..568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.