DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and AT1G07080

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_563779.1 Gene:AT1G07080 / 837219 AraportID:AT1G07080 Length:265 Species:Arabidopsis thaliana


Alignment Length:189 Identity:50/189 - (26%)
Similarity:91/189 - (48%) Gaps:17/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SNKLHITLLYESLCPDSRNF-MHQLGPVYE-EFGDYIDILLVPFGKSQSERNGAIFHCQHGPAEC 94
            |.|:.:.|.||||||...:| ::.|..::| :....:|:.|.|:|.::...:.....||||..||
plant    36 SPKVSVGLYYESLCPYCSSFIVNHLAKLFEDDLISIVDLHLSPWGNTKLRSDNVTAVCQHGAFEC 100

  Fly    95 KGNRLQSCVINSTANQAAQVKFVVC-QMLAPD--YSRIDQCANEAGLLT-DVVHCLSSETGTKLQ 155
            ..:.:::|.|::....:....|:.| :.|..:  |.:.:.|..:..|.: .|..||||..|.:|.
plant   101 FLDTVEACAIDAWPKVSDHFPFIYCVEKLVTEHKYDKWETCYEKLNLNSKPVADCLSSGHGNELA 165

  Fly   156 LQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVCYMLR--QQNLLPSSST 210
            |.....|....|  .::|.:|.:|   |.|.:    |:...:.|:.:  :.|.:|.:.|
plant   166 LHYAAETNALQPPHKYVPWVVVDG---QPLYE----DYENFISYICKAYKGNKVPGACT 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 27/104 (26%)
AT1G07080NP_563779.1 GILT 40..144 CDD:308710 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.