DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and OSH1

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_195778.1 Gene:OSH1 / 831721 AraportID:AT5G01580 Length:233 Species:Arabidopsis thaliana


Alignment Length:215 Identity:56/215 - (26%)
Similarity:94/215 - (43%) Gaps:29/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 STASLLLLVLSLGWAKLEEKPREKRQSNKLHITLLYESLCPDSRNFMHQLGPVYEEFG--DYIDI 68
            ::.::...:|||.            .|.|:.::|.||:|||....|:....|...|.|  ..||:
plant    10 TSCTIFFCLLSLS------------SSQKVTLSLYYEALCPFCAEFIVNRLPKIFETGLISSIDL 62

  Fly    69 LLVPFGKSQSERNGAIFHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQ---MLAPDYSRID 130
            .|||:|.:....:|.|. ||||.|||..|.:.:|.||:..:......::.|.   :|.....:..
plant    63 QLVPWGNAAIRPDGTIL-CQHGEAECALNAIHACAINAYPDVMKHFGYIYCTEQLVLENKLEKWA 126

  Fly   131 QCANEAGLLTDVVHCLSSETGTKLQLQAELVTKQYSPS--FIPTIVYNGVFDQQLQDHSLRDFRG 193
            .|....||....|.|..:..|.:|:.:....|.:..|:  |:|.:|.|.:   .||:    :::.
plant   127 DCLEMVGLSRAAVDCYINGYGNQLEQRYAEETSELYPAHRFVPWVVVNNL---PLQE----NYQN 184

  Fly   194 TVCYMLRQ--QNLLPSSSTI 211
            .|.|:...  .|.:|.:..|
plant   185 FVMYVCNAYGSNQVPEACRI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 32/104 (31%)
OSH1NP_195778.1 GILT 29..130 CDD:281251 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.