DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and GILT

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001154228.1 Gene:GILT / 826908 AraportID:AT4G12960 Length:243 Species:Arabidopsis thaliana


Alignment Length:235 Identity:64/235 - (27%)
Similarity:96/235 - (40%) Gaps:47/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKLASTASLLLLV----LSLGWAKLEEKPREKRQSNKLHITLLYESLCPDSRNF-MHQLGPVYE 60
            :|||.....||||.    |..|            :|.|:.:.|.||||||..:.| :..||.:: 
plant     6 LTKLVFFGCLLLLTFTDNLVAG------------KSGKVKLNLYYESLCPGCQEFIVDDLGKIF- 57

  Fly    61 EFGDY-----IDILLVPFGKSQSERNGAIFHCQHGPAECKGNRLQSCVI----------NSTANQ 110
               ||     .|:.|.|||.::...|..: .||||..|||.|.|::|.:          :....|
plant    58 ---DYDLYTITDLKLFPFGNAELSDNLTV-TCQHGEEECKLNALEACALRTWPDQFDKCDGYGTQ 118

  Fly   111 AAQVKFVVCQMLAPDYSRIDQCANEAGLLTDVVHCLSSETGTKLQLQAELVTKQYSP--SFIPTI 173
            .:|..|:.|  :..|....:.|...:|....:..|.:.:...||.|.....||...|  .::|.:
plant   119 KSQYSFIRC--VESDTKGWESCVKNSGREKAINDCYNGDLSRKLILGYATKTKNLKPPHEYVPWV 181

  Fly   174 VYNG-VFDQQLQDHSLRDFRGTVCYMLRQQNLLPSSSTIC 212
            ..|| ..|..:|  |..|....:|...:.:..||.   :|
plant   182 TLNGKPLDDSVQ--STDDLVAQICNAYKGKTTLPK---VC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 34/115 (30%)
GILTNP_001154228.1 GILT 33..141 CDD:281251 34/114 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.