DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and AT4G12900

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_193026.1 Gene:AT4G12900 / 826902 AraportID:AT4G12900 Length:231 Species:Arabidopsis thaliana


Alignment Length:224 Identity:64/224 - (28%)
Similarity:101/224 - (45%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TKLASTASLLLLVLS-----LGWAKLEEKPREKRQSNKLHITLLYESLCPDSRNF-MHQLGPVYE 60
            |||...|.|||...|     .|            :|:|:.:.|.||||||..:|| :|.||.::.
plant    11 TKLVFFACLLLFTFSSHNLVAG------------ESDKVKLNLYYESLCPSCQNFIVHHLGKIFN 63

  Fly    61 -EFGDYIDILLVPFGKSQSERNGAIFHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQMLAP 124
             :.....|:.|:|||.:....:..: .||||..|||.|.|::|.|.:..||....||:.|  :..
plant    64 TDLHTITDLKLIPFGNAHVSDDLTV-TCQHGEEECKLNALEACAIRTWPNQRLHYKFIRC--VET 125

  Fly   125 DYSRIDQCANEAGLLTDVVHCLSSETGTKLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHS 187
            :.:..:.|..:.|....:..|.:.:...:|.|.....|....|  .::|.:..||   :.|.: :
plant   126 NTNAWESCVKKYGGEKAINDCYNGDLSKELILGYANQTLSLKPEHKYVPWMTLNG---EPLYE-N 186

  Fly   188 LRDFRGTVCYMLRQQNLLPS---SSTICQ 213
            :.||...||...:.:..||.   ||.:.|
plant   187 IGDFVDLVCKAYKGKAALPKLCYSSVLSQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 34/101 (34%)
AT4G12900NP_193026.1 GILT 38..137 CDD:367408 34/101 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.