DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and AT4G12890

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_567395.1 Gene:AT4G12890 / 826901 AraportID:AT4G12890 Length:232 Species:Arabidopsis thaliana


Alignment Length:190 Identity:62/190 - (32%)
Similarity:94/190 - (49%) Gaps:21/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SNKLHITLLYESLCPDSRNF-MHQLGPVYEEFGDYI---DILLVPFGKSQSERNGAIFHCQHGPA 92
            |||:.|.|.||||||..:|| :..||.:::  .|.:   |:.|||||.:....|..| .||||..
plant    36 SNKVKINLYYESLCPYCQNFIVDDLGKIFD--SDLLKITDLKLVPFGNAHISNNLTI-TCQHGEE 97

  Fly    93 ECKGNRLQSCVINSTANQAAQVKFVVCQMLAPDYSRIDQCANEAGLLTDVVHCLSSETGTKLQLQ 157
            |||.|.|::|.|.:..:...|.||:.|  :..|.:..:.|..::|....:..|.:.:...||.|.
plant    98 ECKLNALEACGIRTLPDPKLQYKFIRC--VEKDTNEWESCVKKSGREKAINDCYNGDLSQKLILG 160

  Fly   158 AELVTKQYSP--SFIPTIVYNGVFDQQLQD--HSLRDFRGTVCYMLRQQNL--LPSSSTI 211
            ...:|....|  .::|.:..||   :.|.|  |:|   ...||...:.::|  |.|||.:
plant   161 YAKLTSSLKPKHEYVPWVTLNG---KPLYDNYHNL---VAQVCKAYKGKDLPKLCSSSVL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 38/103 (37%)
AT4G12890NP_567395.1 GILT 40..139 CDD:367408 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.