DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and Ifi30

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_075552.2 Gene:Ifi30 / 65972 MGIID:2137648 Length:248 Species:Mus musculus


Alignment Length:233 Identity:61/233 - (26%)
Similarity:103/233 - (44%) Gaps:61/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SLLLLVLSL-----GWAKLEEKPREKRQSNKLH-----------------ITLLYESLCPDSRNF 51
            |||||:..|     ..|.|.:...|...:.|.|                 ::|.|||||...|.|
Mouse    11 SLLLLLFPLEVPRAATASLSQASSEGTTTCKAHDVCLLGPRPLPPSPPVRVSLYYESLCGACRYF 75

  Fly    52 M-HQLGPVYEEFGDYIDILLVPFGKSQSERNGA---IFHCQHGPAECKGNRLQSCVINSTANQAA 112
            : ..|.|.:....:.::|.|||:|.:| |||.:   .|.||||..||:.|.:::|:::....:||
Mouse    76 LVRDLFPTWLMVMEIMNITLVPYGNAQ-ERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAA 139

  Fly   113 QVKFVVC---------------QMLAPDYSRIDQCANEAGLLTDVVHCLSSETGTKLQLQ-AELV 161
            .:. :||               |:.||:.|.           ..::.|.:.:.||:|..: |:|.
Mouse   140 FLT-IVCMEEMDDMEKKLGPCLQVYAPEVSP-----------ESIMECATGKRGTQLMHENAQLT 192

  Fly   162 TKQYSP-SFIPTIVYNGVFDQQLQDHSLRDFRGTVCYM 198
            ...:.| .::|.::.|   ::.|:|.|  :....||.:
Mouse   193 DALHPPHEYVPWVLVN---EKPLKDPS--ELLSIVCQL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 37/135 (27%)
Ifi30NP_075552.2 GILT 61..163 CDD:281251 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.