DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and CG41378

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001163836.1 Gene:CG41378 / 5740475 FlyBaseID:FBgn0085638 Length:228 Species:Drosophila melanogaster


Alignment Length:172 Identity:54/172 - (31%)
Similarity:89/172 - (51%) Gaps:12/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KLHITLLYESLCPDSRNFM-HQLGPVYEEFGDYIDILLVPFGKSQS-ERNGAI-FHCQHGPAECK 95
            |:.:|:.||:|||||:.|: .||.|.::.....:::.|.|:||::: |.||.| |.|||||.||:
  Fly    45 KVVVTVYYEALCPDSKYFLTKQLLPTFKIAKSIMEVKLAPYGKAKTKEHNGKITFDCQHGPIECQ 109

  Fly    96 GNRLQSCVINSTANQAAQVKFVVCQMLAPDYS---RIDQCANEAGLLTDVV-HCLSSETGTKLQL 156
            .|...:|......:...:::...| |:..::|   .:::|.::......|: :|..|..|..|..
  Fly   110 ANIYHACAAEIIEDPLLRLEVATC-MIMDNHSPQEAMNKCTSQINFDDSVIQNCFESYRGVDLLK 173

  Fly   157 QAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVC 196
            .....|....|  :|||||..:|  .|..|:..|:|....||
  Fly   174 VIGESTNSLRPPITFIPTITIDG--SQGRQESILKDLLSEVC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 34/105 (32%)
CG41378NP_001163836.1 GILT 47..152 CDD:281251 34/105 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D124553at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1070
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - P PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
76.820

Return to query results.
Submit another query.