DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and si:dkey-197i20.6

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:XP_693944.2 Gene:si:dkey-197i20.6 / 565583 ZFINID:ZDB-GENE-131127-557 Length:256 Species:Danio rerio


Alignment Length:176 Identity:50/176 - (28%)
Similarity:78/176 - (44%) Gaps:15/176 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LHITLLYESLCPDSRNFM-HQLGPVYEEFGDYIDILLVPFGKSQSERNGAIFHCQHGPAECKGNR 98
            :.|:|.|||||...|.|: .||.|.:....|.:.:.|||||.::.......|.||||..||..|.
Zfish    67 VEISLYYESLCSGCRAFLTEQLFPTWTLLKDIMKVNLVPFGNAKEVPEENSFSCQHGEPECYANM 131

  Fly    99 LQSCVINSTANQAAQVKFVVCQMLAPDYSRIDQCANEAGLL-------TDVVHCLSSETGTKLQL 156
            :::||:....:.|..|  :.|...:.|   :.|.|.....|       ..:..|...|.|..|..
Zfish   132 VEACVLYEATHAAFPV--IHCMESSAD---VTQSAKPCLQLYAPFIKWETIESCTRGELGHSLMH 191

  Fly   157 QAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVCYMLR 200
            |..:.|:...|  :.:|.|..||.:..:|:|.::......||.:.:
Zfish   192 QNAVKTQALKPAHTHVPWITINGKYTSELEDKAMSTLFNLVCSLYK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 34/100 (34%)
si:dkey-197i20.6XP_693944.2 SapA <33..54 CDD:295328
GILT 68..168 CDD:281251 34/104 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.