DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and ifi30

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001017196.1 Gene:ifi30 / 549950 XenbaseID:XB-GENE-1002315 Length:256 Species:Xenopus tropicalis


Alignment Length:183 Identity:57/183 - (31%)
Similarity:95/183 - (51%) Gaps:15/183 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 REKRQSNK--LHITLLYESLCPDSRNFM-HQLGPVYEEFGDYIDILLVPFGKSQSERNGA---IF 85
            |:.::|::  :.|.|.|||||...|.|: .||.|.:....:.|::.|||:|.:| |.|..   :|
 Frog    49 RDLKKSSEPAIQIDLFYESLCGGCRGFLVRQLFPSWLMLAEIINVTLVPYGNAQ-ETNITGKWVF 112

  Fly    86 HCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQMLAPDYSR-IDQC----ANEAGLLTDVVHC 145
            .|||||.||.||.:::|:|:...:.......:.|...:.:.:: ::.|    |.|..|.| |:.|
 Frog   113 DCQHGPEECLGNMMEACLIHILDDIYKYFPIIFCMESSNNVTKSLESCLAVYAPELPLKT-VLEC 176

  Fly   146 LSSETGTKLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVC 196
            ::.:.|.||..:....||..||  :::|.||.:|:....||..:.......||
 Frog   177 VNGDLGNKLMHENAQKTKGLSPPHNYVPWIVIDGMHTDDLQAQAQSSLFNLVC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 35/108 (32%)
ifi30NP_001017196.1 GILT 60..161 CDD:281251 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.