DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and Ifi30

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001025197.1 Gene:Ifi30 / 290644 RGDID:1310758 Length:248 Species:Rattus norvegicus


Alignment Length:192 Identity:51/192 - (26%)
Similarity:90/192 - (46%) Gaps:39/192 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PREKRQSNKLHITLLYESLCPDSRNFM-HQLGPVYEEFGDYIDILLVPFGKSQSERNGA---IFH 86
            ||....:..::::|.|||||...|.|: ..|.|.:....:.::|.|||:|.:| |||.:   .|.
  Rat    50 PRRLLSAPPVNVSLYYESLCGACRYFLVRNLFPTWLMVMEIMNITLVPYGNAQ-ERNVSGTWEFT 113

  Fly    87 CQHGPAECKGNRLQSCVINSTANQAAQVKFVVC---------------QMLAPDYSRIDQCANEA 136
            ||||..|||.|::::|:::....:||.:. :||               |:..|:.|.        
  Rat   114 CQHGELECKLNKVEACLLDKLEKEAAFLT-IVCMEEMEDMEKKLGPCLQLYVPEVSP-------- 169

  Fly   137 GLLTDVVHCLSSETGTKLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVC 196
               ..::.|.:.:.||:|..:...:|....|  .::|.::.|   ::.|.|.|  ....:||
  Rat   170 ---ESIMECATGKRGTELMHENAQLTDALQPPHEYVPWVLVN---EKPLTDPS--QLLSSVC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 36/118 (31%)
Ifi30NP_001025197.1 GILT 60..163 CDD:281251 34/104 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.