DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and ZK669.3

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_495669.1 Gene:ZK669.3 / 191388 WormBaseID:WBGene00014053 Length:218 Species:Caenorhabditis elegans


Alignment Length:188 Identity:48/188 - (25%)
Similarity:77/188 - (40%) Gaps:32/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLVLSLGWAKLEEKPREKRQSNKLHITLLYESLCPDSRNFM--HQLGPVYEEFG-------DY 65
            |:|.:..:.:||     .:....:.::|....|..|.|:..:|  |.| |::...|       ||
 Worm    11 LILFITKISYAK-----DKGANGDMVNIVAFGEGRCSDTSYWMKWHWL-PMWRMLGSTGRINFDY 69

  Fly    66 IDILLVPFG------KSQSERNGAIFHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQMLAP 124
                 .|:|      .|:| .:..:..|.||..||..|:||:|||.:..|....::.|.|.....
 Worm    70 -----HPYGIKTTCVDSES-ADDVVCDCHHGNRECLLNQLQACVIEALPNFEDYMEVVTCIQGKQ 128

  Fly   125 DYSRIDQCANEAGLLTD---VVHCLSSETGTKLQLQAELVTKQYSP--SFIPTIVYNG 177
            :.|...:...|.....|   ::.|..|..|.||....|.:..|.:|  .:.|.|:.||
 Worm   129 NISMAAEVCFEGPTKLDRTKMMECAESRHGRKLFSDQENIVAQMAPEMDWAPWILING 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 30/114 (26%)
ZK669.3NP_495669.1 GILT 32..139 CDD:281251 30/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.