DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and ZK669.2

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001364576.1 Gene:ZK669.2 / 191387 WormBaseID:WBGene00014052 Length:234 Species:Caenorhabditis elegans


Alignment Length:194 Identity:55/194 - (28%)
Similarity:86/194 - (44%) Gaps:27/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LHITLLYESLCPD-SRNFMHQLGPVYE--EFGDYIDILLVPFGKSQSERN---GAIFHCQHGPAE 93
            ::|....|||||| :|.|.:.:.||:.  :....|:|...|||.:...|:   |...:|||||||
 Worm    44 INIEFFGESLCPDTTRYFRNHIMPVWTSLQASSTINITYHPFGLASCRRSAETGIRCNCQHGPAE 108

  Fly    94 CKGNRLQSCVINSTANQAAQVKFVVCQMLAPDY-SRIDQCANEAGLLTD-----VVHCLSSETGT 152
            |:.|.||:|||::.......:..|.|......: |.:|.|........|     :..|..|:.|.
 Worm   109 CQLNMLQACVISTLQVPQLYLPIVNCMQGKNKFSSAVDDCIVNFRPRPDLDENFMARCAQSQLGA 173

  Fly   153 KLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVC---------YMLRQQNLL 205
            ||.:|.....|:.:.  .::|.|:.||...|..::    ..:..||         |...|:.|:
 Worm   174 KLMMQHGYRQKEVASELDWVPWILINGRRSQAAEN----QLKTIVCQFSETSKQEYCKTQEELI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 37/106 (35%)
ZK669.2NP_001364576.1 GILT 45..149 CDD:397369 36/103 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.