DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and Y18D10A.2

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_493240.2 Gene:Y18D10A.2 / 189471 WormBaseID:WBGene00012475 Length:212 Species:Caenorhabditis elegans


Alignment Length:180 Identity:47/180 - (26%)
Similarity:69/180 - (38%) Gaps:46/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SLCPDSRNFMH-QLGPVYEEF------GDYIDILLVPFGKSQSERNGAIFHCQHGPAECKGNRLQ 100
            |.|||:..|:| ||.|.|:.:      |..:|...||.|..|.: ...:..|.||..||..|:||
 Worm    45 SRCPDTSKFIHNQLVPFYQNYKGNLSDGLKLDFHAVPTGGHQVD-GKYVNRCLHGALECALNKLQ 108

  Fly   101 ---------------SCVINSTANQAAQVKFVVCQMLAPDYSRIDQCANEAGLLTDVVHCLSSET 150
                           .|:...||..|.    :.|   .||        .|.|.:  |.:|..||.
 Worm   109 MCSKKHIKQDWLVTAGCIQGKTAYSAG----LKC---LPD--------TEEGKI--VQNCAESEE 156

  Fly   151 GTKLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVCYM 198
            |..|...........:|  :::|.|..||..::. .:..|:|   .:|.:
 Worm   157 GEYLLNDENSYRYNVAPHSAWLPWIQVNGERNRN-AEFKLKD---VICQL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 31/114 (27%)
Y18D10A.2NP_493240.2 GILT 39..142 CDD:281251 31/112 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.