DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and C02D5.2

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001040839.1 Gene:C02D5.2 / 176203 WormBaseID:WBGene00015336 Length:323 Species:Caenorhabditis elegans


Alignment Length:214 Identity:56/214 - (26%)
Similarity:93/214 - (43%) Gaps:47/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LEEKPR-----EKRQSNKLHITLLYESLCPD-SRNFMHQLGPVYEEFG--DYIDILLVPFGKSQS 78
            :|.:|:     ::...|.:.:.:..|:.||| ||.|..||...::..|  :.|::.::||||::.
 Worm   121 IEYEPKAGPTIKEPVENIVKLDVYMEAQCPDTSRFFRQQLKKAWDILGRLNRIELNVIPFGKARC 185

  Fly    79 ERNGAIF--HCQHGPAECKGNRLQSCVINSTANQAAQVKFVVC---------------QMLAPDY 126
            ...|..|  .|||||.||:.|:|.:|||:........:..|:|               :....:|
 Worm   186 TEKGNDFECQCQHGPTECQINQLMNCVIDRFGFPHRYLPGVLCMQGKYSLDEAMKCVTENYPSEY 250

  Fly   127 SRIDQCANEAGLLTDVVHCLSSETGTKLQLQAELVTKQYSPS--FIPTIVYNGVFDQQLQDHSLR 189
            .|:.:||             |...|.:|...:...|...:|:  |||.||.||    .....:|.
 Worm   251 ERMRECA-------------SGTRGRRLLALSGQKTASLTPAIDFIPWIVING----SRNSDALY 298

  Fly   190 DFRGTVCYMLRQQNLLPSS 208
            |....||..::.   :||:
 Worm   299 DLTQNVCEAMQP---MPSA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 35/119 (29%)
C02D5.2NP_001040839.1 GILT 140..246 CDD:281251 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.