DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and pqn-48

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_494711.1 Gene:pqn-48 / 173743 WormBaseID:WBGene00004135 Length:319 Species:Caenorhabditis elegans


Alignment Length:168 Identity:55/168 - (32%)
Similarity:79/168 - (47%) Gaps:36/168 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 REKRQSNKLHITLLYESLCPDSRNFM-HQLGPVYEEFGDYIDILLVPFGKSQSERNGAIFHCQHG 90
            |.:||..|  |||:||:|||..:.|: :|||.|:.:|...:.:.|||:|.|:..|:|: |.|.||
 Worm   135 RHRRQPIK--ITLIYEALCPYCQKFIANQLGSVFNQFQGQLILELVPWGNSRIMRDGS-FSCNHG 196

  Fly    91 PAECKGNRLQSCVINSTANQAAQVKFVVC------------------QMLAPDYSRIDQCANEAG 137
            ..||..||||||||:....:.| :.|:||                  ..:...|.:|.|      
 Worm   197 QKECDANRLQSCVIDILKVKGA-LPFIVCFERNIQHYGVEHAMQTCSAFIRSQYRQIRQ------ 254

  Fly   138 LLTDVVHCLSSETGTKLQLQAELVTKQYSPSFIPTIVY 175
                   |.....|.:||.:|...|....|:.|..:.|
 Worm   255 -------CYDGPRGVQLQREAAQKTMSTRPNPILEVPY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 42/118 (36%)
pqn-48NP_494711.1 GILT 142..242 CDD:281251 40/103 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I6054
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I3688
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14302
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.