DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9427 and IFI30

DIOPT Version :9

Sequence 1:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_006323.2 Gene:IFI30 / 10437 HGNCID:5398 Length:250 Species:Homo sapiens


Alignment Length:203 Identity:56/203 - (27%)
Similarity:100/203 - (49%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PREKRQSNKLHITLLYESLCPDSRNFM-HQLGPVYEEFGDYIDILLVPFGKSQSERNGA---IFH 86
            |.:|..:..:::||.||:||...|.|: .:|.|.:....:.:::.|||:|.:| |:|.:   .|.
Human    53 PLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQ-EQNVSGRWEFK 116

  Fly    87 CQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQMLAPDYSR-IDQCAN--EAGLLTD-VVHCLS 147
            ||||..|||.|::::||::....:.|.:. :||.....|..| :..|..  ..||..| ::.|..
Human   117 CQHGEEECKFNKVEACVLDELDMELAFLT-IVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAM 180

  Fly   148 SETGTKLQLQAELVTKQYSP--SFIPTIVYNGVFDQQLQDHSLRDFRGTVC--YMLRQQNLLPSS 208
            .:.|.:|.......|....|  .::|.:..||   :.|:|.:  .....||  |..::.::.|||
Human   181 GDRGMQLMHANAQRTDALQPPHEYVPWVTVNG---KPLEDQT--QLLTLVCQLYQGKKPDVCPSS 240

  Fly   209 S----TIC 212
            :    ::|
Human   241 TSSLRSVC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9427NP_649919.1 GILT 36..136 CDD:281251 34/106 (32%)
IFI30NP_006323.2 GILT 63..164 CDD:308710 34/102 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101707
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.