DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and ldlrap1b

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001074104.1 Gene:ldlrap1b / 791153 ZFINID:ZDB-GENE-070112-1012 Length:304 Species:Danio rerio


Alignment Length:366 Identity:73/366 - (19%)
Similarity:121/366 - (33%) Gaps:119/366 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 FKVSYLGNVLTGWAKAGE---GCVEKQLNTLWRNYTQHSKPDVIMRLKVCASG--LKATTRQHGL 323
            |::.|||..|....|..|   ..|::.:.|......:..|    :.|||...|  |..:.....:
Zfish    47 FQLKYLGMTLVEEPKGEELSAAAVKRIVATAKAGGKKLQK----VTLKVSPRGIILYDSASNQLI 107

  Fly   324 TEYWAHRITYCCAPKNYPRVFCWIYRHEGRKLKHELRCHAVLCSKEKIAQDICDTLRENLESALR 388
            .....:||:||.|.|.:.:||.:|.:.:..:   .|.|||.||:|.|:||.:..|:.:....|..
Zfish   108 ENVSIYRISYCTADKMHDKVFAYIAQSQRNE---TLECHAYLCTKRKVAQAVTLTVAQAFRVAFE 169

  Fly   389 EFKREKILKQNARLSLANAVYDNPSLPRRKIMLSVGGNNYRPPLERSKSAPKLMAIEEAIGEEEG 453
            .::..|..|:.                    .:..|.:.......:|:|:..|.:::   ||...
Zfish   170 FWQTAKEEKEK--------------------QVKCGSDGEAASSSQSESSASLSSMK---GEVAT 211

  Fly   454 DEIEDTNEPEMMPCCQKDSLYPAMTLGRRRCRRGHSIRRTGKIQSFSPCCSSHMAKELPQEETKT 518
            .::.|      :.|..||                    |:||       .::|..:....|...|
Zfish   212 GDLLD------LECGVKD--------------------RSGK-------DAAHPVQNHSTENNNT 243

  Fly   519 MAAAGSSANDGSDSDDFEKLLKFDTTLSNELLPYFDMQLHKNSSQSMVSLSELKEEEGEPLSLLP 583
            :    ....||.|.                                  :.|.|.|....|..|  
Zfish   244 V----WELEDGLDE----------------------------------AFSRLAESCTNPQVL-- 268

  Fly   584 TINSDPSADPEADYNAEDHDVTAP----RRSGVCSDGEEDF 620
                |...:|: |||.|  |..:|    :.....:|.|:.|
Zfish   269 ----DIGVNPQ-DYNPE--DCLSPTHWDKADSEAADAEDAF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 41/182 (23%)
ldlrap1bNP_001074104.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 35/124 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.