DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and nos1apa

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_021332861.1 Gene:nos1apa / 553539 ZFINID:ZDB-GENE-081024-1 Length:505 Species:Danio rerio


Alignment Length:271 Identity:48/271 - (17%)
Similarity:91/271 - (33%) Gaps:83/271 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 RKLKHELRCHAVLCSKEKIAQDICDTLRENLESALREFKREK---------ILKQNARLSLANAV 408
            |::::|.:...:...|..|...:     :.::.|||:.|::|         ::.|:....:....
Zfish    56 RRIRYEFKVKNIKKKKVNIIVSV-----DGVKVALRKKKKKKEWTWDESKMMVMQDPIYRIFYVS 115

  Fly   409 YDNPSLPRRKIMLSVGGNN-YRPPLERSKSAPKLMAIEEAIGEEEGDEIEDTNEPEMMPCCQKDS 472
            :|:..|.....:...|.:| :|..:.:||...:.|.|...:|             :....|.|.|
Zfish   116 HDSQDLKIFSYIARDGQSNVFRCNVFKSKKKSQAMRIVRTVG-------------QAFEVCHKLS 167

  Fly   473 LYPAMTLGRRRCRRGHSIRRTGKIQSFSPCCSSHMAKELPQEE----TKTMAAAGSSANDGSDSD 533
            |                               .|..:....:|    .||...:|.:   |.:..
Zfish   168 L-------------------------------QHTQQNADGQEDGDADKTCTDSGVA---GRELT 198

  Fly   534 DFEKLLKFDTTLSNELLPYFDMQLHKNSSQSMVSLSELKEEE----------------GEPLSLL 582
            ..||....:|.:..|.||..|..:.: .|:.:..|...|::|                ..|..||
Zfish   199 GAEKPAADETDIDAEELPLPDSTMDE-FSRGVTDLDAAKKDEDVSKDKKPSEEPVILLASPKLLL 262

  Fly   583 PTINSDPSADP 593
            |:.:..||:.|
Zfish   263 PSGSDLPSSTP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 17/98 (17%)
nos1apaXP_021332861.1 PTB_CAPON-like 2..180 CDD:269968 25/172 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.