DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and PID1

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_016859893.1 Gene:PID1 / 55022 HGNCID:26084 Length:305 Species:Homo sapiens


Alignment Length:161 Identity:46/161 - (28%)
Similarity:68/161 - (42%) Gaps:21/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 RTHSVDISTPDPEFKVSYLGNVLTGWAKAGEGCVEKQLNTLWRNYTQHSKPDV--------IMRL 307
            ||||        ..||:|||.|.|...:...||.||.:..||:.:|. ::.||        |...
Human   141 RTHS--------GCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTL-AREDVFPANALLEIRPF 196

  Fly   308 KVCASGL--KATTRQHGLTEYWAHRITYCCAPKNY-PRVFCWIYRHEGRKLKHELRCHAVLCSKE 369
            :|....|  |.....| :..:...||.||.|..|. |.:|.|:||.....|.:::.||||.|..:
Human   197 QVWLHHLDHKGEATVH-MDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESK 260

  Fly   370 KIAQDICDTLRENLESALREFKREKILKQNA 400
            ..|:.:...:.|.........|.:..:..|:
Human   261 LEAKKLAHAMMEAFRKTFHSMKSDGRIHSNS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 42/149 (28%)
PID1XP_016859893.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4448
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.