DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and ldlrap1

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001017114.1 Gene:ldlrap1 / 549868 XenbaseID:XB-GENE-954261 Length:309 Species:Xenopus tropicalis


Alignment Length:264 Identity:64/264 - (24%)
Similarity:96/264 - (36%) Gaps:83/264 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 FKVSYLGNVLTGWAKAGE---GCVEKQLNTLWRNYTQHSKPDVIMRLKVCASG--LKATTRQHGL 323
            |.:.|||..|....|..|   ..|::.:.|...:..:..|  ||  |||...|  |........:
 Frog    47 FHLKYLGMTLVEQPKGEELSATAVKRIVATAKASGKKLQK--VI--LKVSPRGIILYDLASNQLI 107

  Fly   324 TEYWAHRITYCCAPKNYPRVFCWIYRHEGRKLKHELRCHAVLCSKEKIAQDICDTL--------- 379
            .....:||:||.|.|.:.:||.:|.:.:..:   .|.|||.||:|.|:||.:..|:         
 Frog   108 ENVSIYRISYCTADKMHDKVFAYIAQSQQNE---TLECHAFLCTKRKMAQAVTLTVAQAFKVAFE 169

  Fly   380 -----RENLESALREFKREK--------------------ILKQNARLSLA-------------- 405
                 |||.|      ||||                    .||.:|..:|.              
 Frog   170 FWQVSRENKE------KREKSGSDGEGASSSQSDGSSSITSLKASASANLLDLEDCAKAFDALNA 228

  Fly   406 --NAVYD----NPSLPRRKIM--LSVGGNNYRPPLERSKSAPKLMAI---------EEAIGEEEG 453
              |.:.|    |.|.....|:  |..|.:.....|..|::.|:::.|         ||.:.....
 Frog   229 SDNHIEDLFRQNESNENNNIVWALDDGLDEAFSRLAESRTNPQVLDIGLTANDLQSEECLSPSSW 293

  Fly   454 DEIE 457
            |::|
 Frog   294 DKLE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 59/238 (25%)
ldlrap1NP_001017114.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 37/124 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.