DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and Pid1

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_038940041.1 Gene:Pid1 / 501174 RGDID:1560766 Length:265 Species:Rattus norvegicus


Alignment Length:162 Identity:43/162 - (26%)
Similarity:63/162 - (38%) Gaps:37/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 RTHSVDISTPDPEFKVSYLGNVLTGWAKAGEGCVEKQLNTLWRNYTQHSKPDVIMRLKVCASGLK 315
            ||||        ..||:|||.|.|...:...||.||.:..||:.:|       :.|.:|..:...
  Rat   101 RTHS--------GCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHT-------LAREEVFPANAL 150

  Fly   316 ATTRQHGLTEYWAH------------------RITYCCAPKNY-PRVFCWIYRHEGRKLKHELRC 361
            ...|..   :.|.|                  ||.||.|..|. |.:|.|:||.....|.:::.|
  Rat   151 LEIRPF---QVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDC 212

  Fly   362 HAVLCSKEKIAQDICDTLRENLESALREFKRE 393
            |||.|..:..|:.:...:.|..:......|.:
  Rat   213 HAVQCESKLEAKKLAHAMMEAFKKTFHSMKSD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 39/150 (26%)
Pid1XP_038940041.1 PTB_P-CLI1 104..242 CDD:269988 39/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.