DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and Ldlrap1

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001102741.1 Gene:Ldlrap1 / 500564 RGDID:1563417 Length:307 Species:Rattus norvegicus


Alignment Length:220 Identity:59/220 - (26%)
Similarity:91/220 - (41%) Gaps:47/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 RSLGKLWRRTHSVDISTPDPEFKVSYLGNVLTGWAKAGE---GCVEKQLNTLWRNYTQHSKPDVI 304
            |.|.:.|..|....:.  ...|.:.|||..|....|..|   ..|::.:.|...:..:..|    
  Rat    28 RKLPENWTDTRETLLE--GMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQK---- 86

  Fly   305 MRLKVCASGLKAT---TRQHGLTEYWA-HRITYCCAPKNYPRVFCWIYRHEGRKLKHELRCHAVL 365
            :.|||...|:..|   |.|  |.|..: :||:||.|.|.:.:||.:|.:.:..:   .|.|||.|
  Rat    87 VTLKVSPRGIILTDSLTSQ--LIENVSIYRISYCTADKMHDKVFAYIAQSQQNE---SLECHAFL 146

  Fly   366 CSKEKIAQDICDTLRENLESALREF---------KREKILKQNARLSLANAVYDNPSLPRRKIML 421
            |:|.|:||.:..|:.:..:.|. ||         ||||..::..         |.|...|     
  Rat   147 CTKRKVAQAVTLTVAQAFKVAF-EFWQVSKEEKEKREKANQEGG---------DVPGTRR----- 196

  Fly   422 SVGGNNYRPPLERSKSAPKLMAIEE 446
                 :..|.|:.|.:...|:.:||
  Rat   197 -----DSTPSLKTSVATGNLLDLEE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 52/194 (27%)
Ldlrap1NP_001102741.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 39/132 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..205 9/44 (20%)
Clathrin box. /evidence=ECO:0000250|UniProtKB:Q5SW96 211..215 1/3 (33%)
AP-2 complex binding. /evidence=ECO:0000250|UniProtKB:Q5SW96 248..275
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000250|UniProtKB:Q5SW96 256..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.