DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and fam43b

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001004547.1 Gene:fam43b / 447808 ZFINID:ZDB-GENE-040912-11 Length:303 Species:Danio rerio


Alignment Length:238 Identity:78/238 - (32%)
Similarity:123/238 - (51%) Gaps:34/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LGKLWR-RTHSVDISTPDPEFKVSYLGNVLTGWAKAGEGCVEKQLNTLW--RNYTQHSKPDVI-- 304
            ||.::. :...|:::..:|.:.|.|||:.:|..|| ||.|.::.:..:|  .||.:.|....|  
Zfish    52 LGSVFHSKRQKVELNKEEPTYNVRYLGSAVTIVAK-GEDCTQEAVAKIWTRSNYGEQSAKMKITV 115

  Fly   305 ----MRLKVCASGLKATTRQHGLTEYWAHRITYCCAPKNYPRVFCWIYRHEGRKLKHELRCHAVL 365
                :|:.|..||.|..:....|     :|||||.|....|::..|||||:.:.....|||||||
Zfish   116 GPHGIRMGVDKSGKKKPSHLFSL-----NRITYCTADPFRPKILAWIYRHQVKNKAVVLRCHAVL 175

  Fly   366 CSKEKIAQDICDTLRENLESALREFKREKILKQNA------RLSLANAVYDNPSLPRRKIMLSVG 424
            .:|.:.|:.:..:|.:|..||..||||   ||:.:      :..|...:.  |.:|.|:::  .|
Zfish   176 LAKAEKARALALSLYQNTTSAFTEFKR---LKRQSDFRHCQQQLLGEDIV--PLMPLRRLL--NG 233

  Fly   425 GNNYRPPLERSKSAPKLMAIEEAIGEEEGDEI---EDTN-EPE 463
            ..:|:||.|:..||.:|.:|.|.  ||:.||:   :.|| .||
Zfish   234 QCHYQPPAEKPGSATRLSSITEE--EEDEDELGGAQSTNTSPE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 63/192 (33%)
fam43bNP_001004547.1 PH-like 71..254 CDD:302622 64/195 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574031
Domainoid 1 1.000 105 1.000 Domainoid score I6582
eggNOG 1 0.900 - - E1_KOG4448
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003422
OrthoInspector 1 1.000 - - otm25286
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11232
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5446
SonicParanoid 1 1.000 - - X2312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.