DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and C1orf226

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001128712.1 Gene:C1orf226 / 400793 HGNCID:34351 Length:315 Species:Homo sapiens


Alignment Length:386 Identity:73/386 - (18%)
Similarity:117/386 - (30%) Gaps:129/386 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 GRKLK---HELRCHAVLCSKEKIAQDICDT----LRENLESALREFKREKILKQNARLSLANAVY 409
            |..||   |.::|..:|.....:::.:..|    :.|||.:||                      
Human    10 GDTLKVTGHYVKCVFLLFVSHLLSEPLSRTVDHGMFENLNTAL---------------------- 52

  Fly   410 DNPSLPRRKIMLSVGGNNYRPPLERSKSAPKLMAIEEAIGEEEGDEIEDTNEPEMMPCCQKDSLY 474
                               .|.|:.|:|.|.|               .....|...|....:...
Human    53 -------------------TPKLQASRSFPHL---------------SKPVAPGSAPLGSGEPGG 83

  Fly   475 PAMTLGRRRCRRGHSIRRTGKIQSFSPCCSSHMAKELPQE-----ETKTMAAAGSSANDGSDSDD 534
            |.:.:|..:..:........|:..|       :.::.|..     .|:....||:....|:|:..
Human    84 PGLWVGSSQHLKNLGKAMGAKVNDF-------LRRKEPSSLGSVGVTEINKTAGAQLASGTDAAP 141

  Fly   535 FEKLLKFDTTLSNELLPYFD----------------MQLHKNSSQSMVSLSELKEE--EGEPLSL 581
             |..|:.:.::..|..|..|                .|....|||.::|..|...|  .|:....
Human   142 -EAWLEDERSVLQETFPRLDPPPPITRKRTPRALKTTQDMLISSQPVLSSLEYGTEPSPGQAQDS 205

  Fly   582 LPTINSDPSAD---PEADYNAEDHDVTAPRRSGVCSDGEEDFLDDADDHYFRHAAMLTMLHRSSM 643
            .||...|..||   |||....|:       |..|..:||...            ::..::|:.|.
Human   206 APTAQPDVPADASQPEATMEREE-------RGKVLPNGEVSL------------SVPDLIHKDSQ 251

  Fly   644 RKMRAADQTSLKY----RHQTQSSISSNASSSTTASTSAAAG---GGSAQQGLTSPDSDEG 697
                  |::.||.    |..:.|.|..|....:.:..|.|..   |....|..||...:||
Human   252 ------DESKLKMTECRRASSPSLIERNGFKLSLSPISLAESWEDGSPPPQARTSSLDNEG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 17/96 (18%)
C1orf226NP_001128712.1 DUF4628 44..315 CDD:292069 66/352 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.