DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and CG14968

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster


Alignment Length:278 Identity:54/278 - (19%)
Similarity:81/278 - (29%) Gaps:132/278 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 FKVSYLGNVLTGWAKAGEGCVEKQLNTLWR-NYTQHSKPDVIM----------------RLKVCA 311
            |||.|:|      ::...|        ||. .||:  :|..||                .|||..
  Fly    24 FKVKYIG------SEVARG--------LWGIKYTR--RPVDIMVGVAKNLPPNKVLPNCELKVST 72

  Fly   312 SGL-------KATTRQHGLTEYWAH---RITYCCAPKNYPRVFCWIYRHEGRKLKHELRCHAVLC 366
            .|:       ||:      ..:|::   .|:|......|.|||..|...: ....|....||.:|
  Fly    73 DGVQLEIISPKAS------INHWSYPIDTISYGVQDLVYTRVFAMIVVKD-ESSPHPFEVHAFVC 130

  Fly   367 SKEKIAQDICDTLRENLESALREFKREKILKQNARLSLANAVYDNPSLPRRKIMLSVGGNNYRPP 431
            ....:|:    .|...|.:|.:::.|.                                      
  Fly   131 DSRAMAR----KLTFALAAAFQDYSRR-------------------------------------- 153

  Fly   432 LERSKSAPKLMAIEEAIGEEEGDEIEDTNEPEMMPCCQKDSLYPAMTLGRRRCRRGHSIRRTGKI 496
                        ::||.|||||:..                  |:.|:...|.:....:|...:|
  Fly   154 ------------VKEATGEEEGEAT------------------PSDTITPTRHKFAIDLRTPEEI 188

  Fly   497 QSFSPCCSSHMAKELPQE 514
            |          |.||.||
  Fly   189 Q----------AGELEQE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 36/204 (18%)
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 34/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11232
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.