DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and Numb

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_038967757.1 Gene:Numb / 29419 RGDID:620107 Length:652 Species:Rattus norvegicus


Alignment Length:568 Identity:107/568 - (18%)
Similarity:173/568 - (30%) Gaps:208/568 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 WRRTHSVDISTPDPEFKVSYLGNVLTGWAKAGEGCVEKQLNTLWRNYTQHSKPDVIMRLK----- 308
            | :|....:.|....|.|.|||:|....::.                 .|...|.:.|||     
  Rat    25 W-QTDEEGVRTGKCSFPVKYLGHVEVDESRG-----------------MHICEDAVKRLKAERKF 71

  Fly   309 ------------------VCASGLKATTRQHG--LTEYWAHRITYCCAPKNYPRVFCWIYR---- 349
                              |.|.||:....:..  :.:....::::|...:|:.|.|.:|.|    
  Rat    72 FKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTT 136

  Fly   350 ------------HEGRKLKHELRCHAVLCSKEKIAQD----ICDTL--------RE---NLESAL 387
                        ..|.:|.|.:.|....|.:.|..::    :..|.        ||   .:.:|.
  Rat   137 RRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTAT 201

  Fly   388 REFKREKILK--QNARLSLANAVYDNPSLPRRKIMLSVGGNNYRPPLERSKSAPKLMAIEEAIGE 450
            .:.:||:|:|  |:|:    .|..|....|      ||...|..|    |.|:|....::.....
  Rat   202 EQAEREEIMKQLQDAK----KAETDKTVGP------SVAPGNSAP----SPSSPTSPTLDPTASL 252

  Fly   451 EEGDEIEDTNEPEMMPCCQKDSLYPAMTLGRRRCRRGHSIRRTGKIQSFSPCCSSHMAKELPQEE 515
            |       .|.|..:|               ||......:.|.|..:.| |..|           
  Rat   253 E-------MNNPHAIP---------------RRHAPIEQLARQGSFRGF-PALS----------- 283

  Fly   516 TKTMAAAGSSANDGSDSDDFEKLLKFDTTLS---NELLPYFDMQLHKNSSQSMVSLSELKEEEGE 577
                                :|:..|...||   |||                .|..:.|.:   
  Rat   284 --------------------QKMSPFKRQLSLRINEL----------------PSTMQRKTD--- 309

  Fly   578 PLSLLPTINSDPSADPEADYNAEDHDVTAPRRSGVCSDGEEDFLDDADDHYFRHAAM---LTMLH 639
                .|..|:.|..:.||:           ..|.:||.....|....:|. |..|.|   :|:: 
  Rat   310 ----FPIKNTVPEVEGEAE-----------SISSLCSQITSAFSTPCEDP-FSSAPMTKPVTLV- 357

  Fly   640 RSSMRKMRAADQTSLKYRHQTQSSIS-SNASSSTTASTSAAAGGGSAQQGLTSPDS---DEGSIS 700
                     |.|:.:...:.|.|::. ..|..::||....|...........:||:   :..:|.
  Rat   358 ---------APQSPVLQANGTDSALHVLTAKPASTALAPVAMPVRETNPWAHAPDAANKEIAAIH 413

  Fly   701 SGCETAST-------VTNANHEEYNSKRVSDPGQLEQSPDLELEQAQV 741
            ||.|...:       :..|.|....|:  :|....|.|..:..:|.||
  Rat   414 SGTEWGQSSGAASPGLFQAGHRRTPSE--ADRWLEEVSKSVRAQQPQV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 47/236 (20%)
NumbXP_038967757.1 PTB_Numb 23..168 CDD:241298 29/160 (18%)
NumbF 259..337 CDD:399368 25/158 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.