DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and Dab1

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_017448664.1 Gene:Dab1 / 266729 RGDID:628770 Length:588 Species:Rattus norvegicus


Alignment Length:120 Identity:27/120 - (22%)
Similarity:47/120 - (39%) Gaps:32/120 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NKFSMEHDSEGCDEVDFIVATHNNNNDYEDLGSVSQAVINTKVAAAAATAAAATP---NNEPNSN 68
            ||..:..|::.||:.|                 :||..:....:...:|.:..||   .:.|:.:
  Rat   481 NKVGVAQDTDDCDDFD-----------------ISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKS 528

  Fly    69 TLKKAKERRT--LFHFGSNKKLSQSKSQESQEAGSKDATPATTAAPLPPVPIGTP 121
            :.....:...  :|..|..   |.|||:| |||  .|.:.|::.:.    |.|.|
  Rat   529 SASHVSDPTADDIFEEGFE---SPSKSEE-QEA--PDGSQASSTSD----PFGEP 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244
Dab1XP_017448664.1 PTB_Dab 25..174 CDD:269926
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.