DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and Numbl

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_006539678.1 Gene:Numbl / 18223 MGIID:894702 Length:608 Species:Mus musculus


Alignment Length:258 Identity:57/258 - (22%)
Similarity:86/258 - (33%) Gaps:74/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GGYDQNDQLTSKA----------YRTLTRSLGKLWRRTHSVDISTPD--PE-------------- 263
            ||..:.||..|.|          :||.:...|.:.:...|:....|.  ||              
Mouse    13 GGPRRPDQHLSPAPCGASGPPETFRTESDGAGTMNKLRQSLRRRKPAYVPEASRPHQWQADEDAV 77

  Fly   264 ------FKVSYLGNVLTGWAKAGEGCVE--KQLNTLWRNYTQHSKPDVIMRLKVCASGLKAT--T 318
                  |.|.|||:|....::....|.:  |:|..:.|.       .|...|.|.|.||:..  .
Mouse    78 RKGTCSFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRK-------SVKSVLWVSADGLRVVDDK 135

  Fly   319 RQHGLTEYWAHRITYCCAPKNYPRVFCWIYR----------------HEGRKLKHELRCHAVLCS 367
            .:..|.:....::::|...:|..:.|.:|.|                ..|.:|.|.:.|....|.
Mouse   136 TKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAFAACL 200

  Fly   368 KEK----------IAQDICDT--LRE---NLESALREFKREKILKQNARLSLANAVYDNPSLP 415
            :.|          .|.|...|  .||   .|....|..:||...|:.|..:.|.||...|:.|
Mouse   201 ERKQRREKECGVTAAFDASRTSFAREGSFRLSGGGRPAEREAGDKKKAEAAAAPAVAPGPAQP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 45/208 (22%)
NumblXP_006539678.1 PTB_Numb 68..202 CDD:241298 27/140 (19%)
PHA03247 <263..594 CDD:223021 1/1 (100%)
NumbF 293..375 CDD:368837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.