DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and Numb

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_006515635.2 Gene:Numb / 18222 MGIID:107423 Length:740 Species:Mus musculus


Alignment Length:456 Identity:85/456 - (18%)
Similarity:149/456 - (32%) Gaps:159/456 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 QEHVG---RTGGYDQNDQLTSKAYRTLTRSLGKLWRRTHSV---DISTP-----DPE-------- 263
            |.|:.   .|||...::..:.:..:.....|.:.:||...|   :.|.|     |.|        
Mouse    61 QSHIATDWSTGGPQSSNTFSRQVVKVNMNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCS 125

  Fly   264 FKVSYLGNVLTGWAKAGEGCVEKQLNTLWRNYTQHSKPDVIMRLK-------------------- 308
            |.|.|||:|....::.                 .|...|.:.|||                    
Mouse   126 FPVKYLGHVEVDESRG-----------------MHICEDAVKRLKAERKFFKGFFGKTGKKAVKA 173

  Fly   309 ---VCASGLKATTRQHG--LTEYWAHRITYCCAPKNYPRVFCWIYR----------------HEG 352
               |.|.||:....:..  :.:....::::|...:|:.|.|.:|.|                ..|
Mouse   174 VLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTG 238

  Fly   353 RKLKHELRCHAVLCSKEKIAQD----ICDTL--------RE---NLESALREFKREKILK--QNA 400
            .:|.|.:.|....|.:.|..::    :..|.        ||   .:.:|..:.:||:|:|  |:|
Mouse   239 ERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDA 303

  Fly   401 RLSLANAVYDNPSLPRRKIMLSVGGNNYRPPLERSKSAPKLMAIEEAIGEEEGDEIEDTNEPEMM 465
            :.:..:.....||:        ..||....|...:...|            :|....:.|.|..:
Mouse   304 KKAETDKTVVGPSV--------APGNTAPSPSSPTSPTP------------DGTASSEMNNPHAI 348

  Fly   466 P--------CCQKDSL--YPAMTLGRRRCRRGHSI----------RRT------------GKIQS 498
            |        ..::.|.  :||::......:|..|:          |:|            |:.:|
Mouse   349 PRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNTVPEVEGEAES 413

  Fly   499 FSPCCSS-HMAKELPQEE-------TK--TMAAAGSSANDGSDSDDFEKLL---KFDTTLSNELL 550
            .|..||. ..|...|.|:       ||  |:.|..|.....:.:|....:|   ..:|.|::..:
Mouse   414 ISSLCSQITSAFSTPSEDPFSSAPMTKPVTLVAPQSPVLQANGTDSASHVLTAKPANTALAHVAM 478

  Fly   551 P 551
            |
Mouse   479 P 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 44/244 (18%)
NumbXP_006515635.2 PTB_Numb 110..255 CDD:241298 28/161 (17%)
NumbF 347..425 CDD:368837 13/77 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.