DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and FAM43B

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_997217.1 Gene:FAM43B / 163933 HGNCID:31791 Length:329 Species:Homo sapiens


Alignment Length:288 Identity:86/288 - (29%)
Similarity:128/288 - (44%) Gaps:64/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LGKLWR-RTHSVDISTPDPEFKVSYLGNVLTGWAKAGEGCVEKQLNTLWRNYTQHSKPDVIMRLK 308
            ||:::| |...|:::..||.:.|.||||.:|..|| |:||.:..:..:|..              
Human    52 LGRVFRSRRQKVELNKEDPTYTVWYLGNAVTLHAK-GDGCTDDAVGKIWAR-------------- 101

  Fly   309 VCASG----LKATTRQHGLT-------------------EYWAHRITYCCAPKNYPRVFCWIYRH 350
             |..|    :|.|...||:.                   .|...|||||.|...:||||.|:|||
Human   102 -CGPGGGTKMKLTLGPHGIRMQPCERSAAGGSGGRRPAHAYLLPRITYCTADGRHPRVFAWVYRH 165

  Fly   351 EGRKLKHELRCHAVLCSKEKIAQDICDTLRENLESALREFKREKILKQNAR------LSLANAVY 409
            :.|.....|||||||.::...|:.:...||:...:|..:|||.: .:.:||      |....|..
Human   166 QARHKAVVLRCHAVLLARAHKARALARLLRQTALAAFSDFKRLQ-RQSDARHVRQQHLRAGGAAA 229

  Fly   410 DNPSLPRRKIMLSVGGNNYR-PPLERSKSAPKLMAIEEAIGEEEGDEIED-------TNEPEMM- 465
            ..|..|.|:::.:...  || ||.|||:.||:|.:|:|...|||.|:.|:       ...||:: 
Human   230 SVPRAPLRRLLNAKCA--YRPPPSERSRGAPRLSSIQEEDEEEEEDDAEEQEGGVPQRERPEVLS 292

  Fly   466 ------PCCQKDSLYPAMTLGRRRCRRG 487
                  .|..:.:..|......||.:.|
Human   293 LARELRTCSLRGAPAPPPPAQPRRWKAG 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 64/208 (31%)
FAM43BNP_997217.1 PH-like 71..263 CDD:418428 65/210 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..329 24/78 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141139
Domainoid 1 1.000 111 1.000 Domainoid score I6245
eggNOG 1 0.900 - - E1_KOG4448
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003422
OrthoInspector 1 1.000 - - otm40360
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11232
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5446
SonicParanoid 1 1.000 - - X2312
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.