DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and DAB1

DIOPT Version :10

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_066566.3 Gene:DAB1 / 1600 HGNCID:2661 Length:555 Species:Homo sapiens


Alignment Length:120 Identity:29/120 - (24%)
Similarity:49/120 - (40%) Gaps:32/120 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NKFSMEHDSEGCDEVDFIVATHNNNNDYEDLGSVSQAVINTKVAAAAATAAAATP---NNEPNSN 68
            ||..:..|::.||:.|                 :||..:....:...:|.:..||   .:.|:.:
Human   448 NKVGVAQDTDDCDDFD-----------------ISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKS 495

  Fly    69 TLKKAKERRT--LFHFGSNKKLSQSKSQESQEAGSKDATPATTAAPLPPVPIGTP 121
            :...|.:..|  :|..|..   |.|||:| |||  .|.:.|::.:.    |.|.|
Human   496 SASHASDPTTDDIFEEGFE---SPSKSEE-QEA--PDGSQASSNSD----PFGEP 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:405418
DAB1NP_066566.3 PTB_Dab 25..174 CDD:269926
PHA03247 <235..437 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.