DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and pid1

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:XP_004917881.1 Gene:pid1 / 100485427 XenbaseID:XB-GENE-960454 Length:217 Species:Xenopus tropicalis


Alignment Length:152 Identity:38/152 - (25%)
Similarity:67/152 - (44%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 PDPEFKVSYLGNVLTGWAKAGEGCVEKQLNTLWRNYTQHSKPDVI----------MRLKVCASGL 314
            |....||:|||.|.|...:...||.|:.:..||:.:|. ::.||.          .::::....|
 Frog    54 PHAGCKVTYLGKVSTTGGQFASGCTEQPVIELWKQHTL-AREDVFPSNALLEIRPFQVRLHHQDL 117

  Fly   315 KATTRQHGLTEYWAHRITYCCAPKNY-PRVFCWIYRHEGRKLKHELRCHAVLCSKEKIAQDICDT 378
            |.....| :..:...||.||.|..|. |.:|.|:||.....|..::.||||.|..:..|:.:...
 Frog   118 KGEATVH-MDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSFQMDCHAVECESKLEAKKLAHA 181

  Fly   379 LRENLESALREFKREKILKQNA 400
            :....:...:..:.:..:.|::
 Frog   182 MMVAFKKTFQSMRSDGRIHQDS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 37/149 (25%)
pid1XP_004917881.1 PTB_P-CLI1 56..194 CDD:269988 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.