DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8312 and LOC100361087

DIOPT Version :9

Sequence 1:NP_649918.1 Gene:CG8312 / 41163 FlyBaseID:FBgn0037720 Length:866 Species:Drosophila melanogaster
Sequence 2:NP_001177388.1 Gene:LOC100361087 / 100361087 RGDID:2320873 Length:292 Species:Rattus norvegicus


Alignment Length:237 Identity:53/237 - (22%)
Similarity:85/237 - (35%) Gaps:73/237 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NTLKKAKERRTLFHFGSNKKLSQSKSQESQEAGSKDAT---------PATTAAPL--PPVPIGTP 121
            |.|.:.||..:|   ||...:..:|:.|:|..|.:||.         ....|.||  ||.|| |.
  Rat    85 NDLLRRKESSSL---GSVGVMEINKTAEAQMPGGEDAACGPWLEDERSVQEAFPLLDPPPPI-TR 145

  Fly   122 PRQHKFVKSN-----SLARLLGN-TYNAKKFEKQEQ------KRLASGSEGGKFNTYSGRRGRAG 174
            .|..:.:|:.     |...:|.| .|..:....|.|      :.:::.:...:..|..|.:|.|.
  Rat   146 KRTPRALKTTQDMLISSQPVLSNLEYGTELSPGQAQDSPPTAQPVSADTSRPESTTGMGEKGEAL 210

  Fly   175 PYLERFKRVSKEDGDVAGEDDTVRVTNVITLTTDSRDLLYGSRQEHVGR----------TGGYDQ 229
            |           :|:|             :|...  ||::.:.||...|          .|..::
  Rat   211 P-----------NGEV-------------SLLVP--DLIHKNSQEESKRKATEGRKSSSPGPIER 249

  Fly   230 NDQLTSKAYRTLTRSLGKLWRRTHSVDISTPDPEFKVSYLGN 271
            |....|.:    ..||.:.|..      |:|..:.:.|.|.|
  Rat   250 NGLKLSLS----PISLAESWEN------SSPPLQARTSSLEN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8312NP_649918.1 PID_2 263..442 CDD:373244 3/9 (33%)
LOC100361087NP_001177388.1 DUF4628 23..292 CDD:292069 53/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.