DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and APJ1

DIOPT Version :9

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_014322.1 Gene:APJ1 / 855647 SGDID:S000005021 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:42/135 - (31%)
Similarity:50/135 - (37%) Gaps:37/135 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 YKILGVKRSASKQEIVKAYRKAAQKWHPD-NFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFDN 461
            |..|.|..:||..||.||||.||.|:||| |...||.|   :||.:|..|.|:|.|...|..:|.
Yeast     8 YDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESK---RKFQEICQAYEILKDNRLRALYDQ 69

  Fly   462 ---------GEDPLDPESNQRGGFHGEHP----------------FGHF--------QHGSPFQF 493
                     .|.....:..|.|.|.....                |..|        .:||...|
Yeast    70 YGTTDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFNSSATPSSNGSKSSF 134

  Fly   494 KFHFN 498
            .|.||
Yeast   135 NFSFN 139

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR_11 42..108 CDD:290150
TPR repeat 43..71 CDD:276809
TPR repeat 76..106 CDD:276809
TPR_11 78..142 CDD:290150
TPR repeat 111..139 CDD:276809
TPR_1 113..144 CDD:278916
TPR_19 167..234 CDD:291240
TPR repeat 190..220 CDD:276809
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR_11 312..373 CDD:290150
TPR repeat 341..371 CDD:276809