DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment P58IPK and HLJ1

DIOPT Version :9

Sequence 1:	NP_649916.1	Gene:	P58IPK / 41161	FlyBaseID:	FBgn0037718	Length:	498	Species:	Drosophila melanogaster
Sequence 2:	NP_013884.1	Gene:	HLJ1 / 855196	SGDID:	S000004771	Length:	224	Species:	Saccharomyces cerevisiae

Alignment Length:	127	Identity:	47/127 - (37%)
Similarity:	60/127 - (47%)	Gaps:	24/127 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   393 ERRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRR 457
            ::.::|:||.|.|.|:..||.|||||.|.|.|||  ::...|..| .|..|..|.|||::.|||.
Yeast    18 DKHEFYEILKVDRKATDSEIKKAYRKLAIKLHPD--KNSHPKAGE-AFKVINRAFEVLSNEEKRS 79

  Fly   458 QFDN-GEDPLDPESNQRG---GFHG----------------EHPFGHFQHGSPFQ-FKFHFN 498
            .:|. |.||.|.:...||   ||.|                ...||..:.|.|.. |.|.||
Yeast    80 IYDRIGRDPDDRQMPSRGAASGFRGSAGGSPMGGGFEDMFFNSRFGGQRAGPPEDIFDFLFN 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
P58IPK	NP_649916.1	TPR_11	42..108	CDD:290150
		TPR repeat	43..71	CDD:276809
		TPR repeat	76..106	CDD:276809
		TPR_11	78..142	CDD:290150
		TPR repeat	111..139	CDD:276809
		TPR_1	113..144	CDD:278916
		TPR_19	167..234	CDD:291240
		TPR repeat	190..220	CDD:276809
		TPR repeat	225..253	CDD:276809
		TPR repeat	309..337	CDD:276809
		TPR_11	312..373	CDD:290150
		TPR repeat	341..371	CDD:276809
		TPR repeat	376..399	CDD:276809	0/5 (0%)
		DnaJ	395..>485	CDD:223560	41/109 (38%)
		DnaJ	396..460	CDD:278647	29/63 (46%)
HLJ1	NP_013884.1	DnaJ_bact	22..>154	CDD:274090	47/123 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910