DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment P58IPK and DNAJC30

DIOPT Version :9

Sequence 1:	NP_649916.1	Gene:	P58IPK / 41161	FlyBaseID:	FBgn0037718	Length:	498	Species:	Drosophila melanogaster
Sequence 2:	NP_115693.2	Gene:	DNAJC30 / 84277	HGNCID:	16410	Length:	226	Species:	Homo sapiens

Alignment Length:	79	Identity:	26/79 - (32%)
Similarity:	39/79 - (49%)	Gaps:	6/79 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   394 RRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQ 458
            |...|.:|||..:|::.:|..||.:....:|||  |:.....|.::|..|:.|..||.....||:
Human    47 RTALYDLLGVPSTATQAQIKAAYYRQCFLYHPD--RNSGSAEAAERFTRISQAYVVLGSATLRRK 109

  Fly   459 FDNG----EDPLDP 468
            :|.|    ||...|
Human   110 YDRGLLSDEDLRGP 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
P58IPK	NP_649916.1	TPR_11	42..108	CDD:290150
		TPR repeat	43..71	CDD:276809
		TPR repeat	76..106	CDD:276809
		TPR_11	78..142	CDD:290150
		TPR repeat	111..139	CDD:276809
		TPR_1	113..144	CDD:278916
		TPR_19	167..234	CDD:291240
		TPR repeat	190..220	CDD:276809
		TPR repeat	225..253	CDD:276809
		TPR repeat	309..337	CDD:276809
		TPR_11	312..373	CDD:290150
		TPR repeat	341..371	CDD:276809
		TPR repeat	376..399	CDD:276809	1/4 (25%)
		DnaJ	395..>485	CDD:223560	25/78 (32%)
		DnaJ	396..460	CDD:278647	20/63 (32%)
DNAJC30	NP_115693.2	DnaJ	50..111	CDD:278647	20/62 (32%)
DNAJC30	NP_115693.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	116..157		3/8 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165156755
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840