DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P58IPK and Dnaja3

DIOPT Version :9

Sequence 1:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_076135.3 Gene:Dnaja3 / 83945 MGIID:1933786 Length:480 Species:Mus musculus


Alignment Length:157 Identity:56/157 - (35%)
Similarity:77/157 - (49%) Gaps:43/157 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 LLGTEMYDDAIHSFQAALDLEESNTRAKEGIQRAKKLQKQSERRDYYKILGVKRSASKQEIVKAY 416
            |.||:.:     .|........|.:.||:               |||:||||.|:||:::|.|||
Mouse    69 LTGTKSF-----PFVCTTSFHTSASLAKD---------------DYYQILGVPRNASQKDIKKAY 113

  Fly   417 RKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQFD----NGEDPLDPESNQ---RG 474
            .:.|:|:|||..:|:.|  |::||..:|.|.|||:|..||:|:|    .|.||....|.|   ||
Mouse   114 YQLAKKYHPDTNKDDPK--AKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGTSSSGQGYWRG 176

  Fly   475 G-----------FHGE---HPFGHFQH 487
            |           ..||   .|||.||:
Mouse   177 GPSVDPEELFRKIFGEFSSSPFGDFQN 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P58IPKNP_649916.1 TPR_11 42..108 CDD:290150
TPR repeat 43..71 CDD:276809
TPR repeat 76..106 CDD:276809
TPR_11 78..142 CDD:290150
TPR repeat 111..139 CDD:276809
TPR_1 113..144 CDD:278916
TPR_19 167..234 CDD:291240
TPR repeat 190..220 CDD:276809
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR_11 312..373 CDD:290150 4/20 (20%)
TPR repeat 341..371 CDD:276809 4/18 (22%)
TPR repeat 376..399 CDD:276809 4/22 (18%)
DnaJ 395..>485 CDD:223560 47/110 (43%)
DnaJ 396..460 CDD:278647 33/63 (52%)
Dnaja3NP_076135.3 DnaJ 90..480 CDD:223560 51/131 (39%)
DnaJ 93..155 CDD:278647 33/63 (52%)
DnaJ_C 207..416 CDD:199909
DnaJ_zf 236..296 CDD:199908
CXXCXGXG motif 236..243
CXXCXGXG motif 253..260
CXXCXGXG motif 275..282
CXXCXGXG motif 289..296
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..468
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.